Clone Name | rbastl30a10 |
---|---|
Clone Library Name | barley_pub |
>BMR1A_HUMAN (P36894) Bone morphogenetic protein receptor type IA precursor (EC| 2.7.11.30) (Serine/threonine-protein kinase receptor R5) (SKR5) (Activin receptor-like kinase 3) (ALK-3) (CD292 antigen) Length = 532 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = -1 Query: 114 WQVIKISWCCCFLSRVLFLSC----HYKCTSVQDKKRF 13 W V+ IS C ++ ++F SC HY C S+ ++R+ Sbjct: 153 WLVLLISMAVCIIAMIIFSSCFCYKHY-CKSISSRRRY 189
>W_HENDV (P0C1C6) Protein W| Length = 448 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 179 PSSETERFMTWHVLQRHDGTTE-TPHTKEGPNNP 277 PSS ER ++H+ HDG P TK PN P Sbjct: 128 PSSSPERGWSYHMSGTHDGNVRAVPDTKVLPNAP 161
>BMR1A_MOUSE (P36895) Bone morphogenetic protein receptor type IA precursor (EC| 2.7.11.30) (Serine/threonine-protein kinase receptor R5) (SKR5) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) Length = 532 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = -1 Query: 114 WQVIKISWCCCFLSRVLFLSC----HYKCTSVQDKKRF 13 W V+ IS C ++ ++F SC HY C S+ + R+ Sbjct: 153 WLVVLISMAVCIVAMIIFSSCFCYKHY-CKSISSRGRY 189
>V_HENDV (O55777) Nonstructural protein V| Length = 457 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 179 PSSETERFMTWHVLQRHDGTTE-TPHTKEGPNNP 277 PSS ER ++H+ HDG P TK PN P Sbjct: 128 PSSSPERGWSYHMSGTHDGNVRAVPDTKVLPNAP 161
>PHOSP_HENDV (O55778) Phosphoprotein (Protein P)| Length = 707 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 179 PSSETERFMTWHVLQRHDGTTE-TPHTKEGPNNP 277 PSS ER ++H+ HDG P TK PN P Sbjct: 128 PSSSPERGWSYHMSGTHDGNVRAVPDTKVLPNAP 161
>DUT_HHV6U (Q06095) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 376 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = -3 Query: 406 SKLVKMLGLILK*MFILQADTVLCSHPKLFDEPEASCRVVTEIWIVRAFFCMWSFCCAVV 227 SK + LGL+++ +I DT+ K+F+ + + T I I R F FC +++ Sbjct: 293 SKEIAKLGLLIE-TYIWNKDTI--PSIKIFNSTRKTIYIPTGICIARIIFTCGHFCLSLM 349 Query: 226 P 224 P Sbjct: 350 P 350
>DUT_HHV6G (P30007) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 376 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = -3 Query: 406 SKLVKMLGLILK*MFILQADTVLCSHPKLFDEPEASCRVVTEIWIVRAFFCMWSFCCAVV 227 SK + LGL+++ +I DT+ K+F+ + + T I I R F FC +++ Sbjct: 293 SKEIAKLGLLIE-TYIWNKDTI--PSIKIFNSTRKTIYIPTGICIARIIFTCGHFCLSLM 349 Query: 226 P 224 P Sbjct: 350 P 350
>CCMA_YERPE (Q8ZD58) Cytochrome c biogenesis ATP-binding export protein ccmA| (EC 3.6.3.41) (Heme exporter protein A) Length = 218 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 50 WHDRNNTRDRKQQHQEILMTCQSPPI 127 W D+N RDR + HQ++L P I Sbjct: 60 WRDKNIRRDRAKYHQDLLFLGHQPGI 85
>RSMC_BUCBP (Q89AI2) Ribosomal RNA small subunit methyltransferase C (EC| 2.1.1.52) (rRNA (guanine-N(2)-)-methyltransferase) (16S rRNA m2G1207 methyltransferase) Length = 326 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 232 VVPLKNMPCHKSF 194 +V LKN+PCHKSF Sbjct: 287 IVTLKNVPCHKSF 299
>SNAI_DROME (P08044) Protein snail| Length = 390 Score = 28.1 bits (61), Expect = 8.8 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 103 NDLPISSYLHLFTAA--NLSGTQGSSETVFRNRTIYDMACSSEARRHNRNSTYK 258 ND+P+ + HLF A + SG SS + + + +S A H +N +K Sbjct: 193 NDIPLPALFHLFDEAKSSSSGASVSSSSGYSYTPAMSASSASVAANHAKNYRFK 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,732,241 Number of Sequences: 219361 Number of extensions: 1146863 Number of successful extensions: 2729 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2729 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)