Clone Name | rbastl30a02 |
---|---|
Clone Library Name | barley_pub |
>YLB5_CAEEL (P46580) Hypothetical protein C34E10.5 in chromosome III| Length = 734 Score = 30.8 bits (68), Expect = 2.0 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -1 Query: 344 SYVRPLPSCALEIETGMPLVTSSCPILTAFLPLHGH-TPEYKSDHMKCVKHFTQRHLRPN 168 SYV+P+ S + + S P L+ +P HG PE D M ++ + Q H+R N Sbjct: 534 SYVKPIMSTHIH----QTIKAQSIPYLSRAIPSHGRGEPELDEDEM-WIQKYPQGHVRNN 588 Query: 167 TD 162 D Sbjct: 589 MD 590
>GLSK_HUMAN (O94925) Glutaminase kidney isoform, mitochondrial precursor (EC| 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase) Length = 669 Score = 30.8 bits (68), Expect = 2.0 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = -3 Query: 396 WEKAKKGGGDKLIMLPPQLRSSTPFL-----CAGDRNRHAPGDLVMP 271 +E AKK G K+ PQL +P L C D RH+ GD +P Sbjct: 235 YESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVP 281
>GLSK_RAT (P13264) Glutaminase kidney isoform, mitochondrial precursor (EC| 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase) [Contains: Glutaminase kidney isoform 68 kDa chain; Glutaminase kidney isoform 65 kDa chain] Length = 674 Score = 30.0 bits (66), Expect = 3.4 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = -3 Query: 396 WEKAKKGGGDKLIMLPPQLRSSTPFL-----CAGDRNRHAPGDLVMP 271 +E AKK G K+ PQL +P L C D RH+ GD +P Sbjct: 240 YESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVP 286
>TILS_MANSM (Q65UE9) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 426 Score = 24.3 bits (51), Expect(2) = 7.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 354 LPPQLRSSTPFLCAGDRNRHAPG 286 +PP LR+ TP + GD+ + A G Sbjct: 397 VPPWLRNRTPLIFYGDQLKSAVG 419 Score = 23.1 bits (48), Expect(2) = 7.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 470 REV*KVWQGIGFPPRTRKR 414 +++ KVWQ + PP R R Sbjct: 386 QDIKKVWQNLNVPPWLRNR 404
>IRK14_RAT (O70596) ATP-sensitive inward rectifier potassium channel 14| (Potassium channel, inwardly rectifying subfamily J member 14) (Inward rectifier K(+) channel Kir2.4) (IRK4) Length = 434 Score = 28.9 bits (63), Expect = 7.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 371 PPPFFAFSQLPTFKSAFLFLEESQ 442 PPP FSQ+ +F +AFLF E+Q Sbjct: 120 PPPAPCFSQVASFLAAFLFALETQ 143
>IRK14_MOUSE (Q8JZN3) ATP-sensitive inward rectifier potassium channel 14| (Potassium channel, inwardly rectifying subfamily J member 14) (Inward rectifier K(+) channel Kir2.4) (IRK4) Length = 434 Score = 28.9 bits (63), Expect = 7.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 371 PPPFFAFSQLPTFKSAFLFLEESQ 442 PPP FSQ+ +F +AFLF E+Q Sbjct: 120 PPPAPCFSQVASFLAAFLFALETQ 143
>VD05_VARV (P33069) Protein D5| Length = 785 Score = 28.5 bits (62), Expect = 9.9 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +2 Query: 44 NLEENNNKIASCAKLDYYYYCSTLEQLYS*VQ*T*HLHPHQYLVEDDAV*SVSRISYDHS 223 +L+ENN +DY C+ ++ H HPHQ +E+DA+ + + HS Sbjct: 263 DLDENNFTTVPLV-IDYVTPCALCKKRS-------HKHPHQLSLENDAI-RIYKTGNPHS 313 Query: 224 C----IPVCGHEV 250 C +P+ G+++ Sbjct: 314 CKVKIVPLDGNKL 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,289,465 Number of Sequences: 219361 Number of extensions: 1454100 Number of successful extensions: 3321 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3321 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)