Clone Name | rbastl29h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLSK_HUMAN (O94925) Glutaminase kidney isoform, mitochondrial pr... | 32 | 0.52 | 2 | GLSK_RAT (P13264) Glutaminase kidney isoform, mitochondrial prec... | 32 | 0.89 | 3 | YLB5_CAEEL (P46580) Hypothetical protein C34E10.5 in chromosome III | 31 | 1.5 | 4 | AROE_THETN (Q8RAG2) Shikimate dehydrogenase (EC 1.1.1.25) | 29 | 5.8 | 5 | VD05_VARV (P33069) Protein D5 | 28 | 7.6 |
---|
>GLSK_HUMAN (O94925) Glutaminase kidney isoform, mitochondrial precursor (EC| 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase) Length = 669 Score = 32.3 bits (72), Expect = 0.52 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = -3 Query: 396 WEKAKKEXGDKLIMLPPQLRSSTPFL-----CAGDRNRHAPGDLVMP 271 +E AKK+ G K+ PQL +P L C D RH+ GD +P Sbjct: 235 YESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVP 281
>GLSK_RAT (P13264) Glutaminase kidney isoform, mitochondrial precursor (EC| 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase) [Contains: Glutaminase kidney isoform 68 kDa chain; Glutaminase kidney isoform 65 kDa chain] Length = 674 Score = 31.6 bits (70), Expect = 0.89 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = -3 Query: 396 WEKAKKEXGDKLIMLPPQLRSSTPFL-----CAGDRNRHAPGDLVMP 271 +E AKK+ G K+ PQL +P L C D RH+ GD +P Sbjct: 240 YESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVP 286
>YLB5_CAEEL (P46580) Hypothetical protein C34E10.5 in chromosome III| Length = 734 Score = 30.8 bits (68), Expect = 1.5 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -1 Query: 344 SYVRPLPSCALEIETGMPLVTSSCPILTAFLPLHGH-TPEYKSDHMKCVKHFTQRHLRPN 168 SYV+P+ S + + S P L+ +P HG PE D M ++ + Q H+R N Sbjct: 534 SYVKPIMSTHIH----QTIKAQSIPYLSRAIPSHGRGEPELDEDEM-WIQKYPQGHVRNN 588 Query: 167 TD 162 D Sbjct: 589 MD 590
>AROE_THETN (Q8RAG2) Shikimate dehydrogenase (EC 1.1.1.25)| Length = 280 Score = 28.9 bits (63), Expect = 5.8 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +2 Query: 230 PVCGHEVAKRRLKWGMTRSPGACLFLSPAHRKGVDERNCGGNMINLSPXSFFAFS 394 PV VAK + + +P LFL A + GV N ++N + +F+ ++ Sbjct: 209 PVSEEVVAKANFVYDLIYNPSETLFLKYARKNGVKSANGLSMLVNQASYAFYLWT 263
>VD05_VARV (P33069) Protein D5| Length = 785 Score = 28.5 bits (62), Expect = 7.6 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +2 Query: 44 NLEENNNKIASCAKLDYYYYCSTLEQLYS*VQ*T*HLHPHQYLVEDDAV*SVSRISYDHS 223 +L+ENN +DY C+ ++ H HPHQ +E+DA+ + + HS Sbjct: 263 DLDENNFTTVPLV-IDYVTPCALCKKRS-------HKHPHQLSLENDAI-RIYKTGNPHS 313 Query: 224 C----IPVCGHEV 250 C +P+ G+++ Sbjct: 314 CKVKIVPLDGNKL 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,480,631 Number of Sequences: 219361 Number of extensions: 1186550 Number of successful extensions: 2520 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2520 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)