Clone Name | rbastl29h08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PTN22_MOUSE (P29352) Tyrosine-protein phosphatase non-receptor t... | 28 | 8.9 |
---|
>PTN22_MOUSE (P29352) Tyrosine-protein phosphatase non-receptor type 22 (EC| 3.1.3.48) (Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP) Length = 802 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 26 MSMRGIFSQRCKITSIQKEKKKISKPTSDLLKISMFTTKKKDIRVYPSTL 175 M R I Q K QK+K + S+ LK+ +TK K ++YP+T+ Sbjct: 1 MDQREILQQLLK--EAQKKKLNSEEFASEFLKLKRQSTKYKADKIYPTTV 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,466,059 Number of Sequences: 219361 Number of extensions: 937517 Number of successful extensions: 1625 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)