Clone Name | rbastl29h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NOTCH_XENLA (P21783) Neurogenic locus notch protein homolog prec... | 32 | 0.81 | 2 | Y2191_MYCTU (Q10384) Hypothetical protein Rv2191/MT2247 | 30 | 3.1 | 3 | GAOX2_ARATH (Q39111) Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gi... | 30 | 4.0 |
---|
>NOTCH_XENLA (P21783) Neurogenic locus notch protein homolog precursor (XOTCH| protein) Length = 2524 Score = 32.0 bits (71), Expect = 0.81 Identities = 22/80 (27%), Positives = 32/80 (40%) Frame = +3 Query: 186 TDTTKYHYTRSSDPITKFHCHRPPGCMTSINVHDTVVFWAQTVCLGGTSQRSFASTLTTA 365 T+++ ++ D I F C PPG S HD ++ GGT Q S+ + T Sbjct: 987 TESSCFNGGTCIDGINTFTCQCPPGFTGSYCQHDINECDSKPCLNGGTCQDSYGTYKCTC 1046 Query: 366 TSKYTII*CDKTSAEASHSP 425 YT + C SP Sbjct: 1047 PQGYTGLNCQNLVRWCDSSP 1066
>Y2191_MYCTU (Q10384) Hypothetical protein Rv2191/MT2247| Length = 645 Score = 30.0 bits (66), Expect = 3.1 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = -2 Query: 425 RGVRSFR-RSFVALYNGILASCSCQCRSKRTLTRAAKANGLCPEDHSIMDIDACHATRWA 249 R V FR RS A +LA C+ LTR+A+ CPE +++ AC A R Sbjct: 357 RVVGPFRSRSKAAETAALLARCTGLRTCTTRLTRSARHGPACPE----LEVSACPAARDV 412 Query: 248 MAMEFGDWIRAPCVVI 201 A ++ + + +I Sbjct: 413 TAAQYAEAVLRAAALI 428
>GAOX2_ARATH (Q39111) Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20| oxidase 2) (GA 20-oxidase 2) Length = 378 Score = 29.6 bits (65), Expect = 4.0 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 10/66 (15%) Frame = -2 Query: 401 SFVALYNGILASCSCQCRSKRTLTRAAKANGLCPEDHSIM----DIDACHATR------W 252 +F+AL NGI SC + R R + A LCP+ ++ DI TR W Sbjct: 287 TFMALSNGIFKSCLHRAVVNRESARKSMAFFLCPKKDKVVKPPSDILEKMKTRKYPDFTW 346 Query: 251 AMAMEF 234 +M +EF Sbjct: 347 SMFLEF 352 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,321,177 Number of Sequences: 219361 Number of extensions: 1284694 Number of successful extensions: 2668 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2668 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)