Clone Name | rbastl29h01 |
---|---|
Clone Library Name | barley_pub |
>CCG1_MOUSE (O70578) Voltage-dependent calcium channel gamma-1 subunit| (Dihydropyridine-sensitive L-type, skeletal muscle calcium channel gamma subunit) Length = 223 Score = 29.3 bits (64), Expect = 4.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 239 IKHYINWSAACKLTSIHLVSKGILLLVRFSI 147 I+HY +WS AC + L+ G L L+ FS+ Sbjct: 175 IEHYYSWSFACACAAFILLFLGGLFLLLFSL 205
>ADA2B_CAVPO (Q60475) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) Length = 448 Score = 28.9 bits (63), Expect = 5.8 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 14/66 (21%) Frame = +1 Query: 157 LTSRRIPFDTKWMLVNLQAADQLM*CLIL--------------WKIFCR*LFYVSTMVQG 294 LTSR +P LV+L AAD L+ LI+ W+ +C Y++ V Sbjct: 38 LTSRSLPAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFWRTWCE--VYLALDVLF 95 Query: 295 CTCSLV 312 CT S+V Sbjct: 96 CTSSIV 101
>S6A19_PONPY (Q5R6J1) Sodium-dependent neutral amino acid transporter B(0)| (System B(0) neutral amino acid transporter) (B(0)AT1) (Solute carrier family 6 member 19) Length = 634 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = -1 Query: 415 LRWLFIICVAAVWTSLTIVDIKQLSTENHVVWL 317 ++W ++C+A W+ L + I+ + T VV++ Sbjct: 193 IQWRMLLCLACAWSVLYMCTIRGIETTGKVVYI 225
>NHR77_CAEEL (O02316) Nuclear hormone receptor family member nhr-77| Length = 362 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 103 CGFLQYPENVIFHLRGLLIKYCASFF 26 C ++P NV H GL+ CA+FF Sbjct: 11 CPVCEFPSNVELHFGGLVCGACAAFF 36
>NH174_CAEEL (O17748) Nuclear hormone receptor family member nhr-174| Length = 382 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 103 CGFLQYPENVIFHLRGLLIKYCASFF 26 C ++P NV H GL+ CA+FF Sbjct: 65 CPVCEFPSNVELHFGGLVCGACAAFF 90
>GPC6A_CARAU (Q9PW88) G-protein coupled receptor family C group 6 member A| precursor (Odorant receptor 5.24) Length = 877 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -3 Query: 269 NSHLQKIFHNIKHYINWSAACKLTSIHLVSKGILLLVRFSIGFY 138 N++ K + Y W++ + + L + GILLL+ S F+ Sbjct: 546 NANSSKCYPKFYEYFEWNSGFAIALLTLAALGILLLISMSALFF 589 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,734,703 Number of Sequences: 219361 Number of extensions: 1306488 Number of successful extensions: 2349 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2349 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)