Clone Name | rbastl29g05 |
---|---|
Clone Library Name | barley_pub |
>COPB_DICDI (Q23924) Probable coatomer subunit beta (Beta-coat protein)| (Beta-COP) (Fragment) Length = 400 Score = 43.1 bits (100), Expect = 3e-04 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -2 Query: 449 KQVDGKLSGYIRIRSTTQGIALSLGDKI 366 KQ DGK+SGYIRIR+ Q IA++LG+KI Sbjct: 366 KQADGKISGYIRIRAKVQSIAVTLGEKI 393
>COPB_DROME (P45437) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 964 Score = 42.4 bits (98), Expect = 6e-04 Identities = 19/30 (63%), Positives = 26/30 (86%) Frame = -2 Query: 440 DGKLSGYIRIRSTTQGIALSLGDKITLKQK 351 D K++G+IRIR+ +QG+ALSLGDKI+ QK Sbjct: 929 DSKVTGHIRIRAKSQGMALSLGDKISSSQK 958
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 42.0 bits (97), Expect = 7e-04 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = -2 Query: 440 DGKLSGYIRIRSTTQGIALSLGDKITLKQK 351 D ++G+IRIR+ +QG+ALSLGDKI L QK Sbjct: 920 DAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 42.0 bits (97), Expect = 7e-04 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = -2 Query: 440 DGKLSGYIRIRSTTQGIALSLGDKITLKQK 351 D ++G+IRIR+ +QG+ALSLGDKI L QK Sbjct: 920 DAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_SCHPO (Q9UUF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 940 Score = 39.3 bits (90), Expect = 0.005 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 449 KQVDGKLSGYIRIRSTTQGIALSLG 375 K V G +SG++RIRS TQGIALSLG Sbjct: 913 KSVSGPISGHVRIRSKTQGIALSLG 937
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 38.5 bits (88), Expect = 0.008 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = -2 Query: 440 DGKLSGYIRIRSTTQGIALSLGDKITLKQK 351 D ++ +IRIR+ +QG+ALSLGDKI L QK Sbjct: 920 DAAVTVHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_YEAST (P41810) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 973 Score = 36.2 bits (82), Expect = 0.039 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -2 Query: 425 GYIRIRSTTQGIALSLGDKITLKQK 351 GY+RIRS QG+ALSLGD++ L K Sbjct: 939 GYVRIRSKGQGLALSLGDRVALIAK 963
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 4.8 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 160 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 130 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,202,134 Number of Sequences: 219361 Number of extensions: 1097881 Number of successful extensions: 2826 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2826 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)