| Clone Name | rbastl29f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EPSE1_RALSO (P58594) EPS I polysaccharide export inner membrane ... | 28 | 4.2 | 2 | ENV_MCFF3 (P03388) Env polyprotein precursor (Coat polyprotein) ... | 28 | 4.2 | 3 | SRD34_CAEEL (Q19975) Serpentine receptor class delta-34 (Protein... | 28 | 5.5 | 4 | YBD1_SCHPO (O42925) Hypothetical protein C16C6.01c in chromosome II | 28 | 5.5 |
|---|
>EPSE1_RALSO (P58594) EPS I polysaccharide export inner membrane protein epsE| Length = 436 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +2 Query: 116 RSEIHLTFKSQNVSSYHLHLKMTSHWCCYMMLVPLCSGSH 235 R E+ L FK S + HW C ML + G+H Sbjct: 220 RQELRLAFKHALPSVLTTSMGAPVHWICLSMLAAMTDGAH 259
>ENV_MCFF3 (P03388) Env polyprotein precursor (Coat polyprotein) [Contains:| Coat protein GP70; Spike protein p15E; R protein] Length = 640 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 134 TFKSQNVSSYHLHLKMTSHWCCYMMLVPLCSGSHLDFPRSFCV 262 T + + SYHL + W C L P S + LD +CV Sbjct: 370 TTQKTSDGSYHLAAPAGTIWACNTGLTPCLSTTVLDLTTDYCV 412
>SRD34_CAEEL (Q19975) Serpentine receptor class delta-34 (Protein srd-34)| Length = 339 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 92 AMPLCLFWQYNVATNIKTPNSTKN 21 A+P LF++Y TNI N TKN Sbjct: 113 AIPATLFYKYTKVTNINMKNITKN 136
>YBD1_SCHPO (O42925) Hypothetical protein C16C6.01c in chromosome II| Length = 473 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 15 TCILSRIRCFYVSSY 59 TC+L + RCFYV+SY Sbjct: 184 TCVLVQSRCFYVNSY 198 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,556,167 Number of Sequences: 219361 Number of extensions: 859969 Number of successful extensions: 1824 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1824 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)