Clone Name | rbastl29d10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UTX_MOUSE (O70546) Ubiquitously transcribed X chromosome tetratr... | 29 | 5.0 | 2 | YMV6_YEAST (Q04748) Hypothetical 104.7 kDa protein in NCA1-HMS1 ... | 28 | 8.6 |
---|
>UTX_MOUSE (O70546) Ubiquitously transcribed X chromosome tetratricopeptide| repeat protein (Ubiquitously transcribed TPR protein on the X chromosome) (Fragment) Length = 1333 Score = 29.3 bits (64), Expect = 5.0 Identities = 29/98 (29%), Positives = 38/98 (38%), Gaps = 6/98 (6%) Frame = +3 Query: 21 SLN*KHSSQISIQHPSNSTVQLPIP---LLDTHTHKTHIT---SCAFRPPCNRPNSRVRR 182 SLN HS +I Q PI LL +H I S + P R Sbjct: 775 SLNSPHSGLHTINGEGMEESQSPIKTDLLLVSHRPSPQIIPSMSVSIYPSSAEVLKACRN 834 Query: 183 RGKNEGALAQLTHGESPADRPNSLHAPALPERKINSKT 296 GKN + + + + P RP S P LP+ K+N T Sbjct: 835 LGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPT 872
>YMV6_YEAST (Q04748) Hypothetical 104.7 kDa protein in NCA1-HMS1 intergenic| region Length = 898 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 140 ISPTLQPSEL*SSSAGQKRGRPCATYSRRIASRP 241 I+P L+ + SS + PC Y+RRI ++P Sbjct: 658 INPLLESKQQVSSESSLSTSNPCRFYNRRIITKP 691 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,242,571 Number of Sequences: 219361 Number of extensions: 1323072 Number of successful extensions: 3832 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3832 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)