| Clone Name | rbastl29d07 |
|---|---|
| Clone Library Name | barley_pub |
>MDC1_PIG (Q767L8) Mediator of DNA damage checkpoint protein 1| Length = 2042 Score = 30.4 bits (67), Expect = 2.1 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 159 RCCKKTSTASNPAPHGMTMSHATPKRSPRGLAYRS 263 R KT AS P P T TPK + RG A+RS Sbjct: 1347 RSSVKTPAASEPLPSASTDQPITPKPTSRGRAHRS 1381
>KCNAS_DROME (P08510) Potassium voltage-gated channel protein Shaker| Length = 655 Score = 29.6 bits (65), Expect = 3.5 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 30 PVHWYPID-DHN-CPRSELPVSRFLLD*MLETISYPPDLLLCDPMR 161 P H+ PI DH+ C R + VS + L T++ PD LL DP R Sbjct: 83 PQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPAR 128
>OPR1_LYCES (Q9XG54) 12-oxophytodienoate reductase 1 (EC 1.3.1.42)| (12-oxophytodienoate-10,11-reductase 1) (OPDA-reductase 1) (LeOPR1) Length = 376 Score = 29.3 bits (64), Expect = 4.6 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 9/60 (15%) Frame = +2 Query: 137 SPPLRSNALLQEDQHGQQPRSARYDNVPRDAKEV---------APWAGVQVGGAHARLVD 289 +P +RSN + + H +PR D +P+ E A + GV++ GAH L+D Sbjct: 138 TPQIRSNGI--DIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLID 195
>PTPA2_GIBZE (Q4INW6) Serine/threonine-protein phosphatase 2A activator 2 (EC| 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-2) (PPIase PTPA-2) (Rotamase PTPA-2) (Phosphotyrosyl phosphatase activator 2) Length = 432 Score = 28.9 bits (63), Expect = 6.0 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 10/67 (14%) Frame = +3 Query: 168 KKTSTASNPAPHGMTMSHATPKR----------SPRGLAYRSEELMLGS*TCRLTTSYT* 317 K+ S SNP P T + TP S R L+ + ++ L S TC+L T++ Sbjct: 37 KRRSGPSNPTPIPETPALPTPPDTSSNWTFKTPSRRILSKKDHDIFLSSPTCKLVTAWVF 96 Query: 318 GITRVMV 338 G+ +V Sbjct: 97 GLAESIV 103
>SUWA_DROME (P12297) Protein suppressor of white apricot| Length = 963 Score = 28.5 bits (62), Expect = 7.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 419 PAPSDHSERVPGGLRSPSDLAVVL 348 P+ DHSE V GG R+P+ + + + Sbjct: 306 PSADDHSEEVAGGRRNPNQVVITV 329
>DXS_PROMA (Q7VC14) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 643 Score = 28.5 bits (62), Expect = 7.9 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 3/85 (3%) Frame = -3 Query: 380 LRSPSDLAVVLRGGHHDPGDASRV*CGEAAGLRA---EHELLRPVRQPTGRPLWRRVGHC 210 L SDL ++ G P + + C + +G+ A LRP+ Q PL RR+G Sbjct: 501 LSEGSDLLIIAYGSMVAPAQKTAL-CLKESGISATVINARFLRPLDQGLIHPLARRIGKV 559 Query: 209 HTVRSGVXXXXXXXXXAHWIAEEEI 135 T+ G A+++I Sbjct: 560 VTMEEGTLLGGFGSAIVESFADQDI 584 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,360,169 Number of Sequences: 219361 Number of extensions: 1341556 Number of successful extensions: 4083 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4077 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)