| Clone Name | rbastl29d05 |
|---|---|
| Clone Library Name | barley_pub |
>COPB_DICDI (Q23924) Probable coatomer subunit beta (Beta-coat protein)| (Beta-COP) (Fragment) Length = 400 Score = 62.0 bits (149), Expect = 7e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 466 GEDALVNISIEKQVDGKLSGYIRIRSKTQGIALSLGDKI 350 GEDAL NI IEKQ DGK+SGYIRIR+K Q IA++LG+KI Sbjct: 355 GEDALANICIEKQADGKISGYIRIRAKVQSIAVTLGEKI 393
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 59.7 bits (143), Expect = 4e-09 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -1 Query: 466 GEDALVNISIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 335 GEDAL N+SIEK V D ++G+IRIR+K+QG+ALSLGDKI L QK Sbjct: 902 GEDALANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 59.7 bits (143), Expect = 4e-09 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -1 Query: 466 GEDALVNISIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 335 GEDAL N+SIEK V D ++G+IRIR+K+QG+ALSLGDKI L QK Sbjct: 902 GEDALANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_DROME (P45437) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 964 Score = 58.2 bits (139), Expect = 1e-08 Identities = 30/47 (63%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = -1 Query: 466 GEDALVNISIEKQVD---GKLSGYIRIRSKTQGIALSLGDKITLKQK 335 GE+AL N+SIEK VD K++G+IRIR+K+QG+ALSLGDKI+ QK Sbjct: 912 GENALANLSIEKPVDDPDSKVTGHIRIRAKSQGMALSLGDKISSSQK 958
>COPB_SCHPO (Q9UUF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 940 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -1 Query: 466 GEDALVNISIEKQVDGKLSGYIRIRSKTQGIALSLG 359 GEDAL+++S+EK V G +SG++RIRSKTQGIALSLG Sbjct: 902 GEDALMSLSVEKSVSGPISGHVRIRSKTQGIALSLG 937
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 52.8 bits (125), Expect = 4e-07 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 4/48 (8%) Frame = -1 Query: 466 GEDALVNISIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 335 GEDAL N+S EK + D ++ +IRIR+K+QG+ALSLGDKI L QK Sbjct: 902 GEDALANVSSEKPLHQGPDAAVTVHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_YEAST (P41810) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 973 Score = 50.1 bits (118), Expect = 3e-06 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = -1 Query: 466 GEDALVNISIEKQVDGKLS---GYIRIRSKTQGIALSLGDKITLKQK 335 GEDAL N+ IEK D K + GY+RIRSK QG+ALSLGD++ L K Sbjct: 919 GEDALANLCIEK--DSKTNDVIGYVRIRSKGQGLALSLGDRVALIAK 963
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = +1 Query: 1 RH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 144 R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 568 RYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,889,887 Number of Sequences: 219361 Number of extensions: 1103486 Number of successful extensions: 2844 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2839 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)