Clone Name | rbastl29c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CFA_ECOLI (P0A9H7) Cyclopropane-fatty-acyl-phospholipid synthase... | 32 | 0.59 | 2 | CFA_ECOL6 (P0A9H8) Cyclopropane-fatty-acyl-phospholipid synthase... | 32 | 0.59 | 3 | CFA_CITFR (P45509) Cyclopropane-fatty-acyl-phospholipid synthase... | 28 | 8.6 |
---|
>CFA_ECOLI (P0A9H7) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 32.3 bits (72), Expect = 0.59 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -1 Query: 444 LALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSR 331 +A + E+F R++ YYL A +AR + +QVVFSR Sbjct: 334 IADNYSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>CFA_ECOL6 (P0A9H8) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 32.3 bits (72), Expect = 0.59 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -1 Query: 444 LALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSR 331 +A + E+F R++ YYL A +AR + +QVVFSR Sbjct: 334 IADNYSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>CFA_CITFR (P45509) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) (Fragment) Length = 89 Score = 28.5 bits (62), Expect = 8.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 444 LALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSR 331 L+ + F R++ YYL A +AR + +QV+FSR Sbjct: 42 LSSRYSATFRRMFNYYLCACAGAFRARDIELWQVLFSR 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,484,507 Number of Sequences: 219361 Number of extensions: 1358613 Number of successful extensions: 2669 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2669 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)