Clone Name | rbastl29c07 |
---|---|
Clone Library Name | barley_pub |
>LEPA2_RHOBA (Q7UE01) GTP-binding protein lepA2| Length = 598 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 57 WPQPNTVDSIQEDAYIC*IVCPQNWVRPSEIETVVQYTITRDETTNY 197 WP P+T+DS+ E I+ P+ +V P + + + + +T NY Sbjct: 390 WPDPSTIDSVSEPYIKAQILIPEEYVGP--VMELCREHRSESQTMNY 434
>AIR1_YEAST (P40507) Protein AIR1 (Arginine methyltransferase-interacting RING| finger protein 1) Length = 360 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 131 GKAIRNRNRSSVHN-YKG*NNQLHVTRFR*TSTRKEKNSRACSHP*RYPTDHQ 286 GK RN++S +N Y+ NN+ + F + + KN R +HP +P Q Sbjct: 268 GKVQSTRNKNSSNNRYESSNNRKKKSPFSAQNYKVTKNKRVQTHPLDFPRSSQ 320
>PLD_STRAT (Q53728) Phospholipase D precursor (EC 3.1.4.4) (Choline| phosphatase) Length = 556 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 7/42 (16%) Frame = -1 Query: 119 AHDLADIGIFLYGI-------YCIWLWPYLCTDDDDPAKRWI 15 AH ++D+ + L G Y LW + C + DPAK W+ Sbjct: 242 AHPVSDVDMALSGPAAASAGKYLDTLWDWTCRNASDPAKVWL 283
>GRP78_APLCA (Q16956) 78 kDa glucose-regulated protein precursor (GRP 78) (BiP)| (Protein 1603) Length = 667 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 220 FNKKRKKFQGLLTP-LTVPYRSSGAFSPPLGFDQ 318 FN+K+ + +G++ P +T Y SG PP G ++ Sbjct: 625 FNEKKTELEGIVQPIMTKLYEQSGGAPPPSGEEE 658
>GP179_HUMAN (Q6PRD1) Probable G-protein coupled receptor 179 precursor (Probable| G-protein coupled receptor 158-like 1) Length = 2367 Score = 27.3 bits (59), Expect = 9.8 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 9/54 (16%) Frame = +3 Query: 114 VCPQNWVRPSEIETVVQYTI---------TRDETTNYT*HVSGKLQQEKKKIPG 248 VCPQ +RP E T TR+E T+ G+ Q++K+K+PG Sbjct: 1572 VCPQEDLRPEAQEATPAKTEICPWEVNERTREEWTSAQVPRGGESQKDKEKMPG 1625 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,522,153 Number of Sequences: 219361 Number of extensions: 956657 Number of successful extensions: 2155 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2154 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)