Clone Name | rbastl29c01 |
---|---|
Clone Library Name | barley_pub |
>CSPG2_RAT (Q9ERB4) Versican core protein precursor (Large fibroblast| proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP) (Fragments) Length = 2738 Score = 31.2 bits (69), Expect = 1.6 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = +3 Query: 57 QHPSNSTVQLPIPLLDTHTQNTHHLLRISPTLQPSEL*SSSAGQKRGRPCATYSRRIASR 236 QHP + + + ++ + +H+ P +QP+ RP + R+ S+ Sbjct: 617 QHPLTTLMDIIAKKTESDIDHEYHMTSKPPVMQPT------------RP-SVVERKTTSK 663 Query: 237 PSELATCPSLAGEK 278 P EL+T P AG K Sbjct: 664 PQELSTSPPPAGTK 677
>KRF2_COLLI (O93499) Feather keratin Cos1-2 (F-ker)| Length = 100 Score = 29.6 bits (65), Expect = 4.6 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +3 Query: 12 NEPSLN*KHSSQISIQHPSNSTVQLPIPLLDTHTQNT 122 NEP + SS I+IQ PS V LP P+L + QNT Sbjct: 22 NEPCVRQCQSSTIAIQ-PSPVVVTLPGPILSSFPQNT 57
>AMGO1_HUMAN (Q86WK6) Amphoterin-induced protein 1 precursor (Alivin-2)| Length = 493 Score = 29.6 bits (65), Expect = 4.6 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 46 RLASNTPPTQLYSSPSLFLTHTHKTHITSCAFRPPCN 156 RL + PT+L SL L+H H I+S AF P N Sbjct: 75 RLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPN 111
>AMGO1_MOUSE (Q80ZD8) Amphoterin-induced protein 1 precursor (Alivin-2)| Length = 492 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 46 RLASNTPPTQLYSSPSLFLTHTHKTHITSCAFRPPCN 156 RL + PT+L + SL L+H H I+S AF P N Sbjct: 75 RLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPN 111
>AMGO1_RAT (Q80ZD7) Amphoterin-induced protein 1 precursor (Alivin-2)| Length = 493 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 46 RLASNTPPTQLYSSPSLFLTHTHKTHITSCAFRPPCN 156 RL + PT+L + SL L+H H I+S AF P N Sbjct: 75 RLKAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPN 111
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 28.9 bits (63), Expect = 7.8 Identities = 29/94 (30%), Positives = 38/94 (40%), Gaps = 10/94 (10%) Frame = +1 Query: 49 LASNTPPTQLYSSPSLFLTHTHKTHITSCAF--RPPCNRPNSRVRRRGKNEGALAQLTHG 222 ++S+T +SPS H+ F RPP + RR + L H Sbjct: 1964 VSSSTAAAPGATSPSASSASASTRHLQGVEFEMRPP-------LLRRAPSPSLLPASDHK 2016 Query: 223 ESPADRPNSLHAPALPERKI--------NSKTGG 300 SPA RP+SL P LP I +S TGG Sbjct: 2017 VSPAPRPSSL--PILPSGPIYPGLFDIRSSPTGG 2048
>SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2161 Score = 28.9 bits (63), Expect = 7.8 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +1 Query: 82 SSPSLFLTHTHKTHITSCAF--RPPCNRPNSRVRRRGKNEGALAQLTHGESPADRPNSLH 255 +SPS + T H+ F RPP + RR + L H SPA RP+SL Sbjct: 1969 TSPSASSSSTSTRHLQGVEFEMRPP-------LLRRAPSPSLLPASEHKVSPAPRPSSL- 2020 Query: 256 APALP 270 P LP Sbjct: 2021 -PILP 2024 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,028,337 Number of Sequences: 219361 Number of extensions: 1334070 Number of successful extensions: 3958 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3957 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)