Clone Name | rbastl29b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YDEQ_ECOLI (P77588) Hypothetical fimbrial-like protein ydeQ prec... | 27 | 9.0 | 2 | PCX1_MOUSE (Q9QYC1) Pecanex-like protein 1 (Pecanex homolog) (Fr... | 27 | 9.0 |
---|
>YDEQ_ECOLI (P77588) Hypothetical fimbrial-like protein ydeQ precursor| Length = 304 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 185 SLHTAEGRLYQHTQTYSFNIPTYKNILLLGLKYVKP 292 SL + +G LY + TY F + T N+L +G K P Sbjct: 90 SLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMP 125
>PCX1_MOUSE (Q9QYC1) Pecanex-like protein 1 (Pecanex homolog) (Fragment)| Length = 1460 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 108 CGILATVSLYD*GQVHPPHIMQSLIHHCILPRAD 209 CG+L VS + Q + P ++ SL+ I P+AD Sbjct: 321 CGLLVAVSYHLSRQSNDPSVLFSLMQSKIFPKAD 354 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,939,181 Number of Sequences: 219361 Number of extensions: 863306 Number of successful extensions: 1718 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1718 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)