Clone Name | rbastl29a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CP312_DROME (Q9VVN6) Probable cytochrome P450 312a1 (EC 1.14.-.-... | 30 | 1.2 | 2 | SYHH_HUMAN (P49590) Histidyl-tRNA synthetase homolog (EC 6.1.1.2... | 28 | 7.8 |
---|
>CP312_DROME (Q9VVN6) Probable cytochrome P450 312a1 (EC 1.14.-.-) (CYPCCCXIIA1)| Length = 510 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 121 PTELKFTGKIS*LAKLIIP*ELR*LPKLFMVQLDLQKLKAWLTTPVILID 270 P L F G + LAKL+ P LR ++ L + K W+ T + L+D Sbjct: 37 PPALPFIGHLHILAKLVGPHPLRRATEMINEHLHDHRAKLWMGTKLYLVD 86
>SYHH_HUMAN (P49590) Histidyl-tRNA synthetase homolog (EC 6.1.1.21)| (Histidine--tRNA ligase homolog) (HisRS) Length = 506 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 38 AIPSGKMKKKILKPLFSMEKHQSTHENSPQS*NLREKYLDLL 163 A+ + ++K KP F ++ + T + SPQ +REK LDL+ Sbjct: 40 AVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLV 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,316,566 Number of Sequences: 219361 Number of extensions: 699191 Number of successful extensions: 1701 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1701 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)