Clone Name | rbastl29a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CSTN1_DROME (Q9V498) Calsyntenin-1 precursor | 33 | 0.21 | 2 | Y756_AQUAE (O66958) UPF0128 protein aq_756 | 30 | 3.0 | 3 | NPBL_COPCI (Q00333) Protein rad9 (SCC2 homolog) | 30 | 3.0 | 4 | CD53_RAT (P24485) Leukocyte surface antigen CD53 (Cell surface g... | 28 | 8.8 |
---|
>CSTN1_DROME (Q9V498) Calsyntenin-1 precursor| Length = 978 Score = 33.5 bits (75), Expect = 0.21 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 1 TQRNNHFLQMSGANRGNCNNTLTQGRAFGYPVVHVNNV 114 T F + SG+ GN NN T+ + + Y ++H NNV Sbjct: 821 TDNETSFHRNSGSVNGNDNNQPTESKVYSYSLLHTNNV 858
>Y756_AQUAE (O66958) UPF0128 protein aq_756| Length = 229 Score = 29.6 bits (65), Expect = 3.0 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -3 Query: 218 QDTRMRWGFDLGVGQPGLVRGFYVGAAG 135 QD R RWGFDL +G+ VR F+ AG Sbjct: 32 QDLR-RWGFDLILGKKNGVRTFFASQAG 58
>NPBL_COPCI (Q00333) Protein rad9 (SCC2 homolog)| Length = 2157 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 150 VKTAHQTGLPYTKIKPPTHARVLIPYGKSEQATPQ 254 ++T H Y I P THA L+PY K+ T + Sbjct: 1449 IRTIHLFTAAYPSILPGTHASTLLPYLKNASTTEE 1483
>CD53_RAT (P24485) Leukocyte surface antigen CD53 (Cell surface glycoprotein| CD53) (Leukocyte antigen MRC OX-44) Length = 218 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 284 LFFFLWWFYVLGCCLF*FSI 225 LFFF + F+V GCC+ F I Sbjct: 12 LFFFNFLFWVCGCCILGFGI 31 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,155,728 Number of Sequences: 219361 Number of extensions: 1177343 Number of successful extensions: 2745 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2743 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)