| Clone Name | rbastl28h07 |
|---|---|
| Clone Library Name | barley_pub |
>TRPC_BUCSC (Q44603) Tryptophan biosynthesis protein trpCF [Includes:| Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS); N-(5'-phospho-ribosyl)anthranilate isomerase (EC 5.3.1.24) (PRAI)] Length = 461 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -3 Query: 151 VDPVQVYSMNEHQVRSINLLLLSVRKYSFYLTITRIIYNL 32 +DP Q+Y +Q SI LL+LS+ K + Y + ++ Y+L Sbjct: 120 IDPYQIYLARYYQADSI-LLMLSILKDNQYRALEKLAYSL 158
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASLRCCCCYSH 371 C S C+ CCC + + + + + CCC S+ Sbjct: 132 CCQSSCCKPCCCQSSCCVPVCCQSSCCKPCCCQSN 166
>FLIK_SALTY (P26416) Flagellar hook-length control protein| Length = 405 Score = 28.9 bits (63), Expect = 3.1 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +1 Query: 193 KTTDSLTRAEHDRATNTNLSPLDGDVLGAGHVSCAV-VDLPQASRHQSDLHPSVAVA 360 KT SL RA DRAT L+PL V+ A S V VD P A P+++ A Sbjct: 196 KTEASLARASDDRATGPALTPL---VVAAAATSAKVEVDSPPAPVTHGAAMPTLSSA 249
>RL25_BORPA (Q7W180) 50S ribosomal protein L25 (General stress protein CTC)| Length = 204 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +1 Query: 262 GDVLGAGHVSCAVVDLPQA---SRHQSDLHPSVAVAV 363 GD+LG G + A + LP+ + H D +P +A AV Sbjct: 149 GDLLGGGSIHLADIKLPKGVTFNAHGGDTNPLIAAAV 185
>RL25_BORBR (Q7WNY3) 50S ribosomal protein L25 (General stress protein CTC)| Length = 204 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +1 Query: 262 GDVLGAGHVSCAVVDLPQA---SRHQSDLHPSVAVAV 363 GD+LG G + A + LP+ + H D +P +A AV Sbjct: 149 GDLLGGGSIHLADIKLPKGVTFNAHGGDTNPLIAAAV 185
>FIBR_AGKCO (P28891) Fibrolase (EC 3.4.24.72) (Fibrinolytic proteinase)| (Alfimeprase) Length = 203 Score = 28.5 bits (62), Expect = 4.1 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = +1 Query: 193 KTTDSLTRAEHDRATNTNLSPLDGDVLGAGHVSCAVVDLPQASRHQSDLHPSVAVAVTLT 372 + TD L R HD A DGD +G +V + L ++ D H ++ + V LT Sbjct: 83 RETDLLRRQRHDNAQLLTAIDFDGDTVGLAYVG-GMCQLKHSTGVIQD-HSAINLLVALT 140 Query: 373 M 375 M Sbjct: 141 M 141
>RL25_BORPE (Q7VUH2) 50S ribosomal protein L25 (General stress protein CTC)| Length = 208 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +1 Query: 262 GDVLGAGHVSCAVVDLPQA---SRHQSDLHPSVAVAV 363 GD+LG G + A + LP+ + H D +P +A AV Sbjct: 153 GDLLGGGSIHLADIKLPKGVTFNAHGGDTNPLIAAAV 189
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASLRCCCC 362 CA + CQ CC P + + R A R CC Sbjct: 329 CAPTSSCQASCCRPASCVSLLCRPACSRPACC 360
>CVAB_ECOLI (P22520) Colicin V secretion/processing ATP-binding protein cvaB| (EC 3.4.22.-) Length = 698 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 248 YLLWMVMCLEQAMSAVLLLTYHKHQGINQICI 343 YL W+V+C + L+TY ++ I++ C+ Sbjct: 314 YLTWIVLCFTTIYIFIRLVTYGNYRQISEECL 345
>BAZ2B_CHICK (Q9DE13) Bromodomain adjacent to zinc finger domain 2B| (Extracellular matrix protein F22) Length = 2130 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 323 LDACGRSTTAQLTWPAPSTSP 261 L ACG+ TT T PSTSP Sbjct: 485 LSACGKKTTGNRTLVVPSTSP 505
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASLRCCCCYS 368 C S C CCC + + + + + CCC S Sbjct: 157 CCQSSCCNPCCCQSSCCVPVCCQSSCCKPCCCQS 190
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASL--RCC---CCYS 368 C S CQ CC P+ SI + R + RCC CC S Sbjct: 82 CCQSVCCQPTCCRPSCSISSCCRPSCCVSRCCRSQCCQS 120
>KR511_HUMAN (Q6L8G4) Keratin-associated protein 5-11 (Keratin-associated| protein 5.11) (Ultrahigh sulfur keratin-associated protein 5.11) Length = 156 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASLRCCCCYS 368 C S CQ CC P + + + + CCC S Sbjct: 111 CCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQS 144
>Y647_HAEIN (Q57424) Hypothetical protein HI0647| Length = 238 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -2 Query: 320 DACGRSTTAQLTWPAPSTSPSKGDRFVFVALSCSARVRLSVVFSQLLLR 174 DA TTA + W + + G FVF A+ + + +S+ S L+ R Sbjct: 106 DAISGLTTAAIIWASAGIGIAAGAGFVFDAVIATVMILVSIRLSPLVQR 154
>MPS1_BRARE (Q8AYG3) Mitotic checkpoint serine/threonine-protein kinase Mps1| (EC 2.7.12.2) (Monopolar spindle 1) (Nightcap protein) Length = 983 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 113 LMLIHTVHLHRIYNSQSKPRFSIIID 190 L +HT+H H I +S KP +I+D Sbjct: 761 LEAVHTIHKHGIVHSDLKPANFLIVD 786
>TTK_HUMAN (P33981) Dual specificity protein kinase TTK (EC 2.7.12.1)| (Phosphotyrosine picked threonine-protein kinase) (PYT) Length = 841 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 113 LMLIHTVHLHRIYNSQSKPRFSIIID 190 L +HT+H H I +S KP +I+D Sbjct: 616 LEAVHTIHQHGIVHSDLKPANFLIVD 641
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASLRCCC 359 CA + CQ CC P + + R AS R C Sbjct: 257 CAPTSSCQSSCCCPASCVSLLCRPASSRLAC 287
>KRA48_HUMAN (Q9BYQ9) Keratin-associated protein 4-8 (Keratin-associated protein| 4.8) (Ultrahigh sulfur keratin-associated protein 4.8) (Fragment) Length = 114 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASLRCCCC 362 C S CQ CC P+ SI + R + CC Sbjct: 43 CCQSVCCQPTCCHPSCSISSCCRPSCCESSCC 74
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 267 CAWSRPCQLCCC*PTTSIKASIRFASLRCCCC 362 C S CQ CC P+ SI + R + CC Sbjct: 124 CCQSVCCQPTCCHPSCSISSCCRPSCCESSCC 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,568,455 Number of Sequences: 219361 Number of extensions: 845876 Number of successful extensions: 1943 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1942 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)