Clone Name | rbastl28h02 |
---|---|
Clone Library Name | barley_pub |
>APE2_YEAST (P32454) Aminopeptidase 2 (EC 3.4.11.-) (Aminopeptidase II) (AP-II)| (YscII) Length = 844 Score = 39.3 bits (90), Expect = 0.002 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = -2 Query: 386 SPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVRISARW 264 S FTS +K E+ +FFAT+ F+++L QSL+ + A+W Sbjct: 803 SGFTSMQKIDEIKKFFATKSTKGFDQSLAQSLDTITSKAQW 843
>AAP1_YEAST (P37898) Alanine/arginine aminopeptidase (EC 3.4.11.-)| Length = 856 Score = 36.2 bits (82), Expect = 0.019 Identities = 14/40 (35%), Positives = 26/40 (65%) Frame = -2 Query: 380 FTSEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWI 261 FTS E ++S F++ +V F++ L Q+L+ +R A+W+ Sbjct: 799 FTSFEALEKISAFYSRKVTKGFDQTLAQALDTIRSKAQWV 838
>SYI_CHLAB (Q5L5L0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1043 Score = 34.3 bits (77), Expect = 0.073 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -2 Query: 356 EVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPSLAQT-VQQLLLQEF*AAPLY 180 E F T VKP+F +SL R R+ + D K+ SL+Q +QQLL QE+ + L Sbjct: 862 EAPSFVKTTVKPNF-----RSLGR-RVGEKIKDIQKALASLSQAQIQQLLTQEYLSLNLG 915 Query: 179 EEEIMCH 159 EEI+ H Sbjct: 916 SEEIVLH 922
>APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptidase I)| Length = 882 Score = 33.1 bits (74), Expect = 0.16 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -2 Query: 401 VNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWID 258 V S FT ++ +FFA + +ERAL+QSL+ + ++ +ID Sbjct: 819 VRFVTSGFTHASAIDKIKEFFADKDTKLYERALQQSLDTISANSSFID 866
>RS6_RAT (P62755) 40S ribosomal protein S6| Length = 249 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -2 Query: 374 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 237 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_MOUSE (P62754) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -2 Query: 374 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 237 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_HUMAN (P62753) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -2 Query: 374 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 237 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>AMPN_RABIT (P15541) Aminopeptidase N (EC 3.4.11.2) (rbAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (CD13 antigen) Length = 965 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -2 Query: 401 VNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERALKQSLERVRISARWIDSIK 249 + + F++E + ++ QF + F RAL+Q+LE+ R + +W+ K Sbjct: 900 IRAVTRRFSTEYELQQLEQFRLNNLDTGFGSGTRALEQALEQTRANIKWVQENK 953
>AMPN_MOUSE (P97449) Aminopeptidase N (EC 3.4.11.2) (mAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (Membrane protein p161) (CD13 antigen) Length = 965 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -2 Query: 380 FTSEEKAAEVSQFFATRVKPSF---ERALKQSLERVRISARWIDSIK 249 F+SE + ++ QF A F RAL+Q+LE+ R + W+ K Sbjct: 907 FSSEFELQQLEQFKADNSATGFGTGTRALEQALEKTRANIDWVKENK 953
>CLPB_THET2 (Q72IK9) Chaperone clpB| Length = 854 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +3 Query: 240 GLALDAVDPSSADPHPLEALLQRSFERRLHASGKELGNLSSFLLGG 377 GLA ++ + ADP L+ L +R R G E+G + L G Sbjct: 44 GLAWRLLEKAGADPKALKELQERELSRLPKVEGAEVGQYLTSRLSG 89
>DFA1_SYNY3 (Q55393) Diflavin flavoprotein A 1 (EC 1.-.-.-) (SsATF573)| (NADH:oxygen oxidoreductase) Length = 573 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 240 GLALDAVDPSSADPHPLEALLQRSFERRLHASGKELG 350 G+ +D VD SSADP ++ L+ HASG LG Sbjct: 291 GVGVDMVDLSSADPQEIQELVG-------HASGVVLG 320
>AMPN_PIG (P15145) Aminopeptidase N (EC 3.4.11.2) (pAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (gp130) (CD13 antigen) Length = 962 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -2 Query: 380 FTSEEKAAEVSQFFATRVKPSF---ERALKQSLERVRISARWIDSIK 249 F+SE + ++ QF + F RAL+Q+LE+ + + +W+ K Sbjct: 905 FSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENK 951
>IBP3_BOVIN (P20959) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +3 Query: 264 PSSADPHPLEALLQRSFERRLHASGKELGNLSSFLLGGER*NG 392 P DP PL+ALL R L A+ +G L +LL NG Sbjct: 98 PPPGDPRPLQALLD---GRGLCANASAVGRLRPYLLPSASGNG 137
>AMPN_FELCA (P79171) Aminopeptidase N (EC 3.4.11.2) (fAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (CD13 antigen) Length = 966 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -2 Query: 401 VNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERALKQSLERVRISARWIDSIK 249 + + F++E + ++ QF + F RAL+Q+LE+ + + +W+ K Sbjct: 902 IQAVTRRFSTEFELQQLEQFKKNNMDTGFGSATRALEQALEKTKANLKWVKENK 955 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,556,888 Number of Sequences: 219361 Number of extensions: 791341 Number of successful extensions: 1958 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1958 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)