Clone Name | rbastl28g11 |
---|---|
Clone Library Name | barley_pub |
>PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-)| Length = 758 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 102 SSKDVTFSTHLIHIQISLRSKDTTSSAPTCP 194 SSK + S+HL H+ + S +T + A TCP Sbjct: 145 SSKSGSLSSHLFHLATAFGSPNTFTHASTCP 175
>GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 634 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 259 CN*LQSCLVARMDRHATCTHSGGHVGAELVVSFDLKLICICI 134 CN +S LV D TH+G +G SF +L+C+ + Sbjct: 387 CNGARSTLVRESDA-VLLTHAGSEIGVASTKSFTTQLVCLLV 427
>NPY6R_RABIT (P79217) Neuropeptide Y receptor type 6 (NPY6-R)| Length = 371 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -1 Query: 131 VCTESYIFRTDTALSFTSTVCLAFFVDLRSLIFCGVYVSSC 9 VC E + +T+ L TS + L +FV L + C + + C Sbjct: 195 VCVEHWPSKTNQLLYSTSLIMLQYFVPLGFMFICYLKIVIC 235
>EGR2_MOUSE (P08152) Early growth response protein 2 (EGR-2) (Krox-20 protein)| Length = 470 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 138 HIQISLRSKDTTSSAPTCPP 197 H +I LR K+ SSAP+ PP Sbjct: 413 HTKIHLRQKERKSSAPSAPP 432
>COMA_CONMA (Q9TWL9) Conodipine-M alpha chain (EC 3.1.1.4)| Length = 77 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 247 QSCLVARMDRHATCTHSGGHVG 182 Q +A DRH TC H G H G Sbjct: 26 QKXFLAACDRHDTCYHCGKHFG 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,646,454 Number of Sequences: 219361 Number of extensions: 1277560 Number of successful extensions: 3240 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3240 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)