Clone Name | rbastl28f10 |
---|---|
Clone Library Name | barley_pub |
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +3 Query: 9 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 161 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>HSDR_STAAN (Q7A801) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 112 AFFDKKRWCKNKCEV 68 +F DKK WCKNK +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>HSDR_STAAM (Q99X26) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 112 AFFDKKRWCKNKCEV 68 +F DKK WCKNK +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +3 Query: 9 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 131 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133
>RL1D1_PONPY (Q5RCE6) Ribosomal L1 domain-containing protein 1| Length = 490 Score = 28.1 bits (61), Expect = 6.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 245 NVQKIKERDEKRKIARKSVLRLKMDFQLVSSGDAMI 138 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>RL1D1_HUMAN (O76021) Ribosomal L1 domain-containing protein 1 (Cellular| senescence-inhibited gene protein) (PBK1 protein) (CATX-11) Length = 490 Score = 28.1 bits (61), Expect = 6.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 245 NVQKIKERDEKRKIARKSVLRLKMDFQLVSSGDAMI 138 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein NK-2 homolog| B) Length = 269 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +3 Query: 9 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDH 143 + R+ PE ++L TPTQ F +HR+ K+A + KG+ H Sbjct: 145 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH 193
>FDHE_AQUAE (O67150) Protein fdhE homolog| Length = 283 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 124 FHDEAFFDKKRWCKNKCEVC 65 F D+ F+ +RW KN C VC Sbjct: 151 FADKVKFEHERWFKNYCPVC 170 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,305,234 Number of Sequences: 219361 Number of extensions: 571608 Number of successful extensions: 1727 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1727 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)