Clone Name | rbastl28f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calciu... | 29 | 3.2 | 2 | BUD4_YEAST (P47136) Bud site selection protein BUD4 | 27 | 9.2 |
---|
>SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 852 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 220 WNGRDKPKQDDQLFRDRGHSTAVHLNLWLHDPHAGVE 330 W+ RD + DD++ R+ GH H H P AG E Sbjct: 84 WSHRDHGETDDEVSREYGHQPQGHR---YHSPEAGDE 117
>BUD4_YEAST (P47136) Bud site selection protein BUD4| Length = 1447 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -1 Query: 373 ARSRLRNKQ*RTSSVLHQREDHEATGLDELPWNGLDPGRVGHLV 242 +RSR+ N + R SS+ + D+E L WN LDP R L+ Sbjct: 683 SRSRIYNPKSRVSSLNYY--DNEDYILSNSEWNALDPMRRNTLI 724 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,991,186 Number of Sequences: 219361 Number of extensions: 841693 Number of successful extensions: 1623 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1623 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)