Clone Name | rbastl28f06 |
---|---|
Clone Library Name | barley_pub |
>LONH2_MAIZE (P93648) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 964 Score = 52.0 bits (123), Expect = 3e-07 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = -1 Query: 392 LAPNVKEGLDVHFVDTYNEIYKLAFQNE--TETS 297 LA NVKEGL+VHFVDTY+EIY LAFQ++ TETS Sbjct: 931 LASNVKEGLEVHFVDTYSEIYDLAFQSDAGTETS 964
>LONH4_ARATH (Q9M9L7) Putative Lon protease homolog 4, mitochondrial precursor| (EC 3.4.21.-) Length = 942 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -1 Query: 392 LAPNVKEGLDVHFVDTYNEIYKLAF 318 LA NVKEGL+VHFVD Y +I++LAF Sbjct: 914 LARNVKEGLEVHFVDEYEQIFELAF 938
>LONH3_ARATH (Q9M9L8) Putative Lon protease homolog 3, mitochondrial precursor| (EC 3.4.21.-) Length = 924 Score = 41.2 bits (95), Expect = 6e-04 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -1 Query: 392 LAPNVKEGLDVHFVDTYNEIYKLAF 318 LA N+KEGLDVHFVD Y +I+ LAF Sbjct: 896 LAENMKEGLDVHFVDEYEKIFDLAF 920
>LONH2_ARATH (P93655) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 940 Score = 41.2 bits (95), Expect = 6e-04 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -1 Query: 392 LAPNVKEGLDVHFVDTYNEIYKLAF 318 LA NVKEGL+VHFVD Y +I++LAF Sbjct: 909 LAENVKEGLNVHFVDDYGKIFELAF 933
>LONM_HUMAN (P36776) Lon protease homolog, mitochondrial precursor (EC 3.4.21.-)| (Lon protease-like protein) (LONP) (LONHs) Length = 959 Score = 35.4 bits (80), Expect = 0.033 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 392 LAPNVKEGLDVHFVDTYNEIYKLAFQNE 309 LA + EGL+VHFV+ Y EI+ +AF +E Sbjct: 923 LAAFITEGLEVHFVEHYREIFDIAFPDE 950
>LON_CHLTR (O84348) ATP-dependent protease La (EC 3.4.21.53)| Length = 819 Score = 30.8 bits (68), Expect = 0.82 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = -1 Query: 380 VKEGLDVHFVDTYNEIYKLAF 318 +K+GL VHFV Y++++K+AF Sbjct: 796 LKKGLKVHFVTHYDDVFKIAF 816
>LON_CHLMU (Q9PK50) ATP-dependent protease La (EC 3.4.21.53)| Length = 819 Score = 30.8 bits (68), Expect = 0.82 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = -1 Query: 380 VKEGLDVHFVDTYNEIYKLAF 318 +K+GL VHFV Y++++K+AF Sbjct: 796 LKKGLKVHFVTHYDDVFKIAF 816
>YHCE_BACSU (P54589) Hypothetical protein yhcE| Length = 253 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 18 IIKRTKQNLYIFGFVTNL*FFLFHIAP 98 I RTK+ L IFGF + FFL ++P Sbjct: 36 IASRTKEPLVIFGFFVAVAFFLLFLSP 62
>AMPA_MYCPA (Q73YK2) Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 515 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 209 EWPSCKLRSVFSLAPKTLRNLNTLFELLASL 301 EWP+ +R +A ++L N T+F LA+L Sbjct: 100 EWPADTVRRAAGVAARSLSNTETVFTTLAAL 130
>CXCR2_BOVIN (Q28003) High affinity interleukin-8 receptor B (IL-8R B) (CXCR-2)| (CD182 antigen) Length = 360 Score = 27.7 bits (60), Expect = 6.9 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = -3 Query: 255 FGARLNTERSLQLGHSLQDQE*LFVVMIVFS*CPM*QYV*GNFDENVRG*IVEELCEIRK 76 +G L T S Q+GH + +F V++VF C + + D +R ++ E C+ R Sbjct: 231 YGFTLRTLFSAQMGHKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAHVIAETCQRRN 290 Query: 75 TRG 67 G Sbjct: 291 DIG 293
>ALL2_ASPFU (P79017) Major allergen Asp f 2 precursor (Asp f II)| Length = 310 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 386 PNVKEGLDVHFVDTYNEIYKLAFQNETETS 297 P V +G HF D Y+E+ LA N TE++ Sbjct: 192 PAVGQGWVDHFADGYDEVIALAKSNGTEST 221
>PIN2_CAEEL (Q19157) LIM protein pin-2| Length = 329 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Frame = -2 Query: 307 QKQASKQFKQSIQIAQGLWGKTEYGTKFAARPFFA-----RSGVTFCCNDCFFLVSH 152 +K Q +QSI W + ARPFF ++G +C +D L+ H Sbjct: 205 KKVIDPQVEQSIFTMNKHWHTDHFRCATCARPFFGHEHYEKNGKAYCRDDFLELIGH 261
>LONM_YEAST (P36775) Lon protease homolog, mitochondrial precursor (EC 3.4.21.-)| Length = 1133 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 392 LAPNVKEGLDVHFVDTYNEIYKLAFQN 312 L NVKEGL+ D YN+I++ F++ Sbjct: 1083 LPDNVKEGLEPLAADWYNDIFQKLFKD 1109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,214,626 Number of Sequences: 219361 Number of extensions: 826810 Number of successful extensions: 2071 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2071 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)