Clone Name | rbastl28e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FRQ_SORFI (Q09033) Frequency clock protein | 29 | 4.8 | 2 | ZFNL1_ORYSA (Q5NAW2) Zinc finger CCCH type domain-containing pro... | 28 | 8.2 |
---|
>FRQ_SORFI (Q09033) Frequency clock protein| Length = 997 Score = 29.3 bits (64), Expect = 4.8 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = -2 Query: 446 RIAAV-TYPPFPWPLEGVMLVSPLHYRLVAPCSRRERPDVLP---RWYVPGKFSSSHDDD 279 R+A++ T P P P ++++PL VA R P LP +Y P SS DD Sbjct: 815 RLASIRTSSPLPPPRSRNLILAPLQIEYVAGEFHRLNPASLPPPAMFYPPFSTDSSWDDG 874 Query: 278 DNV 270 D++ Sbjct: 875 DDL 877
>ZFNL1_ORYSA (Q5NAW2) Zinc finger CCCH type domain-containing protein ZFN-like 1| Length = 476 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -2 Query: 452 HPRIAAVTYPP--FPWPLEGVMLVSPLHYRLVAPCSRRERPDVLPRWYVPGKFS 297 HP V P +P PL+ + SP Y +A + RP V+P Y+PG ++ Sbjct: 178 HPEFGGVPMTPGIYP-PLQSPSIASPHPYASLANW-QMGRPPVVPGSYIPGSYT 229 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,808,724 Number of Sequences: 219361 Number of extensions: 1225564 Number of successful extensions: 2653 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2653 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)