ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl28d02 |
|---|---|
| Clone Library Name | barley_pub |
>PTP1_ENCHE (O76273) Major polar tube protein precursor (Major PTP) (PTP Eh55)| Length = 453 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -1 Query: 433 ASNPFTSGDSEQSCTL*NI-FISVNRTSHISTPGLSSTKCE 314 +S P T+ D+E S T ++ ++ H TPG SST CE Sbjct: 70 SSTPGTNNDNETSPTTEDVGTCKISVVKHCDTPGASSTPCE 110
>NEU2_LOXAF (P81768) Neurophysin 2 (Neurophysin-II) (E-NP)| Length = 92 Score = 28.5 bits (62), Expect = 8.9 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -3 Query: 254 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 96 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 20 RCFGPSICCGEELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCYEE 77 Query: 95 SCITD 81 SC+T+ Sbjct: 78 SCVTE 82
>NEU2_HORSE (P01182) Neurophysin 2 (Fragment)| Length = 92 Score = 28.5 bits (62), Expect = 8.9 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -3 Query: 254 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 96 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 17 RCFGPSICCGDELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDE 74 Query: 95 SCITD 81 SC+T+ Sbjct: 75 SCVTE 79
>SYG_STRCO (Q9L2H9) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 460 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 298 ILSPYLGPSLDSIHPAVASKSSAAGMYSTYRLIR*NSRRRKQY 170 +LS +LGP+ DS A +A G+++ + ++ SRR+ + Sbjct: 142 LLSTHLGPTQDSGSVAYLRPETAQGIFTNFAQVQTTSRRKPPF 184
>SYG_STRAW (Q82BR9) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 460 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 298 ILSPYLGPSLDSIHPAVASKSSAAGMYSTYRLIR*NSRRRKQY 170 +LS +LGP+ DS A +A G+++ + ++ SRR+ + Sbjct: 142 LLSTHLGPTQDSGSVAYLRPETAQGIFTNFAQVQQTSRRKPPF 184
>NEU2_PIG (P01183) Vasopressin-neurophysin 2-copeptin precursor (AVP-NPII)| [Contains: Lys-vasopressin; Neurophysin 2 (Neurophysin-I/-III); Copeptin] Length = 166 Score = 28.5 bits (62), Expect = 8.9 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -3 Query: 254 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 96 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 51 RCFGPSICCGDELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDE 108 Query: 95 SCITD 81 SC+T+ Sbjct: 109 SCVTE 113
>NEU2_BOVIN (P01180) Vasopressin-neurophysin 2-copeptin precursor (AVP-NPII)| [Contains: Arg-vasopressin; Neurophysin 2 (Neurophysin-II); Copeptin] Length = 166 Score = 28.5 bits (62), Expect = 8.9 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -3 Query: 254 RCCKQKLCCG-----YVQYI*ADKMKQQEEKTIPVLRLSGTVDCGLTGR--AKCVTMRRV 96 RC +CCG +V A+ ++ QEE +P SG CG GR A + Sbjct: 51 RCFGPSICCGDELGCFVGT--AEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDE 108 Query: 95 SCITD 81 SC+T+ Sbjct: 109 SCVTE 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,317,308 Number of Sequences: 219361 Number of extensions: 1388395 Number of successful extensions: 3147 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3147 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
