| Clone Name | rbastl28c12 |
|---|---|
| Clone Library Name | barley_pub |
>NCCH_ALCXX (Q44583) RNA polymerase sigma factor nccH| Length = 186 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 231 IIQRSTIGSWDTYQALNRAGEMKLPWMFIIKLSRLKDLMELRGIGH 368 I+Q + I +W + + ++ PW+F I L++++DL R + H Sbjct: 50 IVQDTFIAAWHALDDFD-SDKLFRPWLFRIGLNKMRDLRRFRQVRH 94
>AKR1_GIBZE (Q4I8B6) Palmitoyltransferase AKR1 (EC 2.3.1.-) (Ankyrin| repeat-containing protein AKR1) Length = 702 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 239 TVHNRIMGYLSGSK*SWRNET--PLDVHHQTLKAEGPDGATRHWPSGGPTRNL 391 T + + G G+ + T PLD +H +L A GP A H GG ++L Sbjct: 553 TTYENMFGIRDGTNITALTSTGAPLDPNHPSLSATGPAAAHSHKHKGGMLKSL 605
>YKE7_YEAST (P36090) Hypothetical 58.9 kDa protein in ELM1-PRI2 intergenic| region Length = 516 Score = 29.3 bits (64), Expect = 2.4 Identities = 21/86 (24%), Positives = 34/86 (39%), Gaps = 2/86 (2%) Frame = +2 Query: 59 TSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGV--DVITSMQKALNGVFWYIY 232 T+K +D G +Y ++ +I N + S GV DV + + + IY Sbjct: 92 TAKTTTYDYGIAYFKQNSFDIIENDNRIDRSKVQMFSLGVIIDVQNASSDSKKHFYKEIY 151 Query: 233 YSTVHNRIMGYLSGSK*SWRNETPLD 310 ++ NR YL W + LD Sbjct: 152 HAYAANRYSSYLESLLGQWIRQRDLD 177
>ISP4_SCHPO (P40900) Sexual differentiation process protein isp4| Length = 785 Score = 29.3 bits (64), Expect = 2.4 Identities = 22/92 (23%), Positives = 45/92 (48%) Frame = +2 Query: 29 YKS*RILTISTSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGVDVITSMQKAL 208 Y++ + +ST+ A F L ++ I S + +I+ ++ ++ D+ + KA Sbjct: 400 YQNYSPIFMSTTYALAFGLSFASITSVIFHVILYHGKEI-YDRLRDPPAPDIHEKLMKAY 458 Query: 209 NGVFWYIYYSTVHNRIMGYLSGSK*SWRNETP 304 + V +Y +Y +V G + G+ W+ ETP Sbjct: 459 DEVPFY-WYLSVFLAFFGMMMGTIYGWKTETP 489
>RUMA_DECAR (Q47HS4) 23S rRNA (uracil-5-)-methyltransferase rumA (EC 2.1.1.-)| (23S rRNA(M-5-U1939)-methyltransferase) Length = 432 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 326 LKAEGPDGATRHWPSGGP 379 L+ +GPD A R +PSGGP Sbjct: 224 LQPKGPDTAFRFYPSGGP 241
>YQU3_CAEEL (Q09550) Hypothetical protein F26C11.3 precursor| Length = 1317 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 284 SWRNETPLDVHHQTLKAEGPDGATRHWPSGGPTRNL 391 S + TP + H T P T +WP+GG TR L Sbjct: 668 STSSSTP-SLKHSTTPTPTPGTTTYNWPTGGTTRML 702 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,961,988 Number of Sequences: 219361 Number of extensions: 1098703 Number of successful extensions: 2250 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2250 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)