| Clone Name | rbastl28c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OTC_PEA (Q43814) Ornithine carbamoyltransferase, chloroplast pre... | 28 | 5.5 | 2 | CID_DROME (P19538) Protein cubitus interruptus | 28 | 7.2 |
|---|
>OTC_PEA (Q43814) Ornithine carbamoyltransferase, chloroplast precursor (EC| 2.1.3.3) (OTCase) (Ornithine transcarbamylase) Length = 375 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +3 Query: 165 CFTTNGGH---TQPQTEAFTSSKNGKMSSIQGSTVSEPRRNACK 287 CFTT G H P + F S + +SS S+ S RR +C+ Sbjct: 10 CFTTVGSHKPYLSPSSHNFRHSPSVSLSSSSSSSPSPLRRISCQ 53
>CID_DROME (P19538) Protein cubitus interruptus| Length = 1397 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +3 Query: 144 EIRIPP*CFTTNGGHTQPQTEAFTSSKN---GKMSSIQGSTVSEPRRNA 281 EI+IP TT GG+T+ + TS +N K ++ GS + RR++ Sbjct: 790 EIKIPKLPNTTIGGYTEDPLQNQTSFRNTVSNKQGTVSGSIQGQFRRDS 838 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,401,851 Number of Sequences: 219361 Number of extensions: 796678 Number of successful extensions: 1411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1411 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)