Clone Name | rbastl28c02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AMELX_RAT (P63278) Amelogenin, X isoform precursor (Leucine-rich... | 29 | 3.1 | 2 | AMELX_MOUSE (P63277) Amelogenin, X isoform precursor (Leucine-ri... | 29 | 3.1 | 3 | AMELX_HUMAN (Q99217) Amelogenin, X isoform precursor | 28 | 8.9 |
---|
>AMELX_RAT (P63278) Amelogenin, X isoform precursor (Leucine-rich amelogenin| peptide) (LRAP) Length = 210 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 12 YLHHRSIGVLIFLHPTSNSPSPPYNFPLWEEEEKVTDQR 128 +LHH+ I VL HP S++ P ++ P+ ++ V Q+ Sbjct: 75 WLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQ 113
>AMELX_MOUSE (P63277) Amelogenin, X isoform precursor (Leucine-rich amelogenin| peptide) (LRAP) Length = 210 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 12 YLHHRSIGVLIFLHPTSNSPSPPYNFPLWEEEEKVTDQR 128 +LHH+ I VL HP S++ P ++ P+ ++ V Q+ Sbjct: 75 WLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQ 113
>AMELX_HUMAN (Q99217) Amelogenin, X isoform precursor| Length = 191 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 12 YLHHRSIGVLIFLHPTSNSPSPPYNFPLWEEEEKVTDQR 128 +LHH+ I VL HP +++ P ++ P+ ++ V Q+ Sbjct: 60 WLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQ 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,680,518 Number of Sequences: 219361 Number of extensions: 366412 Number of successful extensions: 1005 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1005 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)