Clone Name | rbastl28b11 |
---|---|
Clone Library Name | barley_pub |
>DRL31_ARATH (Q9FLB4) Putative disease resistance protein At5g05400| Length = 874 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 234 YFCRFLSGICIGVTFILDGLYLVR 163 Y RFL+ C G+T + DGLY +R Sbjct: 574 YSLRFLNLSCTGITSLPDGLYALR 597
>YAO7_SCHPO (Q10086) Putative transcriptional regulatory protein C11D3.07c| Length = 603 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 59 AWESRIHR*NTTDIVPTKQESWK 127 A + +HR +TD+ P K ESWK Sbjct: 283 AQQLNLHRKQSTDVEPEKAESWK 305
>GALR2_RAT (O08726) Galanin receptor type 2 (GAL2-R) (GALR2)| Length = 372 Score = 28.1 bits (61), Expect = 5.7 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 217 LGNLYRCNFYPGWFVPRAARQSVCSCVAS-ILPRLLLSWYY 98 L NL C +P W PR +C+ V S +LP L+LS Y Sbjct: 169 LANLTVC--HPAWSAPRRRAMDLCTFVFSYLLPVLVLSLTY 207
>GALR2_MOUSE (O88854) Galanin receptor type 2 (GAL2-R) (GALR2)| Length = 371 Score = 28.1 bits (61), Expect = 5.7 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 217 LGNLYRCNFYPGWFVPRAARQSVCSCVAS-ILPRLLLSWYY 98 L NL C +P W PR +C+ V S +LP L+LS Y Sbjct: 168 LANLTVC--HPAWSAPRRRAMDLCTFVFSYLLPVLVLSLTY 206
>DUT_NEUCR (Q6MVL2) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 165 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 175 QTIQDKSYTDTDSREEPTEISVHGVGGLHQTEIGNGRG 288 Q + ++ YT E E SV G GG T +G+G G Sbjct: 123 QLVLERIYTPEVVEVEQLEESVRGAGGFGSTGVGSGVG 160
>BRSK1_HUMAN (Q8TDC3) BR serine/threonine-protein kinase 1 (EC 2.7.11.1) (SAD1| kinase) (SAD1A) Length = 794 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -3 Query: 174 YLVRRGSPSVRASRQFFQDSCLVGTMSVVFYLCIRDSQARTLSLKNCNNL 25 YLV++G + + +R+FF+ + +C RD + L L NN+ Sbjct: 137 YLVKKGRLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNI 186
>GALR2_HUMAN (O43603) Galanin receptor type 2 (GAL2-R) (GALR2)| Length = 387 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 217 LGNLYRCNFYPGWFVPRAARQSVCSCVAS-ILPRLLLSWYY 98 L NL C +P W PR +C+ V S +LP L+L Y Sbjct: 169 LANLTVC--HPAWSAPRRRAMDICTFVFSYLLPVLVLGLTY 207 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,881,573 Number of Sequences: 219361 Number of extensions: 992307 Number of successful extensions: 2658 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2658 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)