ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl28b01 |
|---|---|
| Clone Library Name | barley_pub |
>APE2_YEAST (P32454) Aminopeptidase 2 (EC 3.4.11.-) (Aminopeptidase II) (AP-II)| (YscII) Length = 844 Score = 57.4 bits (137), Expect = 8e-09 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSS-SLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSL 231 W+K NWD +VK P S++ V S FTS +K E+ +FFAT+ F+++L QSL Sbjct: 775 WVKKNWDELVKRLPPGLSMLGSVVTLGTSGFTSMQKIDEIKKFFATKSTKGFDQSLAQSL 834 Query: 230 ERVRISARW 204 + + A+W Sbjct: 835 DTITSKAQW 843
>PSA_HUMAN (P55786) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA)| Length = 919 Score = 53.5 bits (127), Expect = 1e-07 Identities = 27/88 (30%), Positives = 46/88 (52%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLE 228 ++KDNW+ + + LIS + +V F ++ A EV FF + PS ER ++Q E Sbjct: 830 FIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCE 889 Query: 227 RVRISARWIDSIKSEPSLAQTVQQLLLQ 144 + ++A W+ A+++ Q LLQ Sbjct: 890 NILLNAAWLKRD------AESIHQYLLQ 911
>PSA_MOUSE (Q11011) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA)| Length = 920 Score = 52.0 bits (123), Expect = 3e-07 Identities = 27/88 (30%), Positives = 45/88 (51%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLE 228 ++KDNW+ + + LIS + +V F ++ A EV FF + PS ER ++Q E Sbjct: 831 FIKDNWEELHNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCE 890 Query: 227 RVRISARWIDSIKSEPSLAQTVQQLLLQ 144 + ++A W+ A ++ Q LLQ Sbjct: 891 NILLNAAWLKRD------ADSIHQYLLQ 912
>AAP1_YEAST (P37898) Alanine/arginine aminopeptidase (EC 3.4.11.-)| Length = 856 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/70 (28%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTW-PSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSL 231 W++++WD + K P S ++ + ++ FTS E ++S F++ +V F++ L Q+L Sbjct: 769 WMQEHWDEIAKRLQPGSPVLGGVLTLGLTNFTSFEALEKISAFYSRKVTKGFDQTLAQAL 828 Query: 230 ERVRISARWI 201 + +R A+W+ Sbjct: 829 DTIRSKAQWV 838
>APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptidase I)| Length = 882 Score = 39.3 bits (90), Expect = 0.002 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -3 Query: 395 NWDHVVKTWPSSSLISDFVNSTV-SPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVR 219 NWD ++ P + + +V V S FT ++ +FFA + +ERAL+QSL+ + Sbjct: 800 NWDKLLSRLPVAGTMRGYVVRFVTSGFTHASAIDKIKEFFADKDTKLYERALQQSLDTIS 859 Query: 218 ISARWID 198 ++ +ID Sbjct: 860 ANSSFID 866
>AMPN_LACHE (Q10730) Aminopeptidase N (EC 3.4.11.2) (Lysyl aminopeptidase)| (Lys-AP) (Alanine aminopeptidase) Length = 844 Score = 36.6 bits (83), Expect = 0.015 Identities = 17/74 (22%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVK-PSFERALKQSL 231 W++++WD + KT + F+ T F + E+ E +FF ++ P R +K + Sbjct: 759 WIREDWDWLDKTVGGDMEFAKFITVTAGVFHTPERLKEFKEFFEPKINVPLLSREIKMDV 818 Query: 230 ERVRISARWIDSIK 189 + + I++ K Sbjct: 819 KVIESKVNLIEAEK 832
>SYI_CHLAB (Q5L5L0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1043 Score = 34.3 bits (77), Expect = 0.072 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -3 Query: 296 EVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPSLAQT-VQQLLLQEF*AAPLY 120 E F T VKP+F +SL R R+ + D K+ SL+Q +QQLL QE+ + L Sbjct: 862 EAPSFVKTTVKPNF-----RSLGR-RVGEKIKDIQKALASLSQAQIQQLLTQEYLSLNLG 915 Query: 119 EEEIMCH 99 EEI+ H Sbjct: 916 SEEIVLH 922
>AMPN_MOUSE (P97449) Aminopeptidase N (EC 3.4.11.2) (mAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (Membrane protein p161) (CD13 antigen) Length = 965 Score = 33.5 bits (75), Expect = 0.12 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSL-ISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERALK 240 +++ NW + + + S ++ + F+SE + ++ QF A F RAL+ Sbjct: 877 FVRSNWKKLFENYGGGSFSFANLIQGVTRRFSSEFELQQLEQFKADNSATGFGTGTRALE 936 Query: 239 QSLERVRISARWIDSIK 189 Q+LE+ R + W+ K Sbjct: 937 QALEKTRANIDWVKENK 953
>AMPN_PIG (P15145) Aminopeptidase N (EC 3.4.11.2) (pAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (gp130) (CD13 antigen) Length = 962 Score = 33.5 bits (75), Expect = 0.12 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSL-ISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERALK 240 +++ NW + + + S S+ + F+SE + ++ QF + F RAL+ Sbjct: 875 FVQSNWKKLFQDYGGGSFSFSNLIQGVTRRFSSEFELQQLEQFKKNNMDVGFGSGTRALE 934 Query: 239 QSLERVRISARWIDSIK 189 Q+LE+ + + +W+ K Sbjct: 935 QALEKTKANIKWVKENK 951
>AMPN_FELCA (P79171) Aminopeptidase N (EC 3.4.11.2) (fAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (CD13 antigen) Length = 966 Score = 33.5 bits (75), Expect = 0.12 Identities = 17/77 (22%), Positives = 40/77 (51%), Gaps = 4/77 (5%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSL-ISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERALK 240 +++ NW + + + + S S+ + + F++E + ++ QF + F RAL+ Sbjct: 879 FVQSNWKKLFQDYGTGSFSFSNLIQAVTRRFSTEFELQQLEQFKKNNMDTGFGSATRALE 938 Query: 239 QSLERVRISARWIDSIK 189 Q+LE+ + + +W+ K Sbjct: 939 QALEKTKANLKWVKENK 955
>AMPN_RABIT (P15541) Aminopeptidase N (EC 3.4.11.2) (rbAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (CD13 antigen) Length = 965 Score = 33.1 bits (74), Expect = 0.16 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 11/79 (13%) Frame = -3 Query: 392 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 246 WD V W S ++ + + F++E + ++ QF + F RA Sbjct: 875 WDFVQSNWKKLFEDFGGGSFSFANLIRAVTRRFSTEYELQQLEQFRLNNLDTGFGSGTRA 934 Query: 245 LKQSLERVRISARWIDSIK 189 L+Q+LE+ R + +W+ K Sbjct: 935 LEQALEQTRANIKWVQENK 953
>AMPE_HUMAN (Q07075) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopeptidase| A) (APA) (Differentiation antigen gp160) (CD249 antigen) Length = 957 Score = 33.1 bits (74), Expect = 0.16 Identities = 17/70 (24%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKP-SFERALKQSL 231 W++ NWD++V + ++ + + PF +E + ++ FFA + + E+ +Q L Sbjct: 870 WIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVL 929 Query: 230 ERVRISARWI 201 E V+ + W+ Sbjct: 930 ETVKNNIEWL 939
>AMPN_HUMAN (P15144) Aminopeptidase N (EC 3.4.11.2) (hAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (gp150) (Myeloid plasma membrane glycoprotein CD13) (CD13 antigen) Length = 966 Score = 32.3 bits (72), Expect = 0.28 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 11/79 (13%) Frame = -3 Query: 392 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 246 WD V W S S+ + + F++E + ++ QF + F RA Sbjct: 876 WDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRA 935 Query: 245 LKQSLERVRISARWIDSIK 189 L+Q+LE+ + + +W+ K Sbjct: 936 LEQALEKTKANIKWVKENK 954
>AMPN_RAT (P15684) Aminopeptidase N (EC 3.4.11.2) (rAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 antigen) Length = 964 Score = 31.6 bits (70), Expect = 0.47 Identities = 17/77 (22%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSL-ISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERALK 240 +++ NW + + + S ++ + F+SE + ++ QF F RAL+ Sbjct: 877 FVRSNWKKLFEDYGGGSFSFANLIQGVTRRFSSEFELQQLEQFKEDNSATGFGSGTRALE 936 Query: 239 QSLERVRISARWIDSIK 189 Q+LE+ + + +W+ K Sbjct: 937 QALEKTKANIKWVKENK 953
>AMPN2_LACLA (Q48656) Aminopeptidase N (EC 3.4.11.2) (Lysyl aminopeptidase)| (Lys-AP) (Alanine aminopeptidase) Length = 848 Score = 30.8 bits (68), Expect = 0.80 Identities = 18/82 (21%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQS-L 231 W K+NW+ + FVN F ++E+ + FF + ++AL+++ L Sbjct: 765 WAKENWEWIKAALGGDMSFDSFVNIPAGIFKNQERLDQYIAFFEPQTS---DKALERNIL 821 Query: 230 ERVRISARWIDSIKSEPSLAQT 165 ++ A +D I+ E + ++ Sbjct: 822 MGIKTIAARVDLIEKEKAAVES 843
>AMPN1_LACLA (Q9CIQ1) Aminopeptidase N (EC 3.4.11.2) (Lysyl aminopeptidase)| (Lys-AP) (Alanine aminopeptidase) Length = 846 Score = 30.8 bits (68), Expect = 0.80 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 5/80 (6%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATR-----VKPSFERAL 243 W K NW + + FV + F + +K AE FF + +K S E A+ Sbjct: 759 WEKANWAFLEEKLGGDMSYDKFVIYPGNTFKTADKLAEYKAFFEPKLENQGLKRSIEMAI 818 Query: 242 KQSLERVRISARWIDSIKSE 183 KQ RV + IDS K++ Sbjct: 819 KQITARVAL----IDSQKAD 834
>AMPE_MOUSE (P16406) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopeptidase| A) (APA) (BP-1/6C3 antigen) Length = 945 Score = 30.8 bits (68), Expect = 0.80 Identities = 16/71 (22%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKP-SFERALKQSL 231 W++ NWD++V + + + + PF +E + ++ FFA + + +Q L Sbjct: 861 WIQLNWDYLVSRFTINDRYLGRIVTIAEPFNTELQLWQMQSFFAKYPNAGAGAKPREQVL 920 Query: 230 ERVRISARWID 198 E V+ + W++ Sbjct: 921 ETVKNNIEWLN 931
>AMPN_LACLC (P37897) Aminopeptidase N (EC 3.4.11.2) (Lysyl aminopeptidase)| (Lys-AP) (Alanine aminopeptidase) Length = 845 Score = 30.4 bits (67), Expect = 1.0 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATR-----VKPSFERAL 243 W K NW + + FV + F + +K AE FF + +K S E A+ Sbjct: 758 WEKANWAFLEEKLGGDMSYDKFVIYPGNTFKTADKLAEYKAFFEPKLENQGLKRSIEMAI 817 Query: 242 KQSLERVRISARWIDSIKSEPSLAQT 165 KQ RV + IDS K+ A T Sbjct: 818 KQITARVAL----IDSQKAAVDKAIT 839
>AMPE_RAT (P50123) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopeptidase| A) (APA) Length = 945 Score = 30.4 bits (67), Expect = 1.0 Identities = 16/70 (22%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKP-SFERALKQSL 231 W++ NWD++V + + + + PF +E + ++ FFA + + +Q L Sbjct: 861 WIQLNWDYLVNRFTINDRYLGRIVTIAEPFNTELQLWQMQSFFAKYPNAGAGAKPREQVL 920 Query: 230 ERVRISARWI 201 E V+ + W+ Sbjct: 921 ETVKNNIEWL 930
>ACOX2_CANMA (Q00468) Acyl-coenzyme A oxidase 2 (EC 1.3.3.6) (Acyl-CoA oxidase| 2) (AOX 2) Length = 724 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -3 Query: 404 LKDNWDHVVKTWPSSS--LISDFVNSTVSPFTSEEKAAEVSQ 285 LKD +DH KT P ++ +++D ++S P S++ A E S+ Sbjct: 7 LKDEYDHPTKTDPDTNPKIVADIISSKEPPQPSQDVAEERSR 48
>RS6_RAT (P62755) 40S ribosomal protein S6| Length = 249 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -3 Query: 314 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 177 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_MOUSE (P62754) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -3 Query: 314 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 177 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_HUMAN (P62753) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -3 Query: 314 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 177 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>AMPE_PIG (Q95334) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopeptidase| A) (APA) Length = 942 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/70 (21%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -3 Query: 407 WLKDNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKP-SFERALKQSL 231 W++ NW+++V + + + + PF +E + ++ FF + + E+ +Q L Sbjct: 860 WIQLNWEYLVNRYTLNDRNLGRIVTIAEPFNTELQLWQMESFFKRYPEAGAGEKPREQVL 919 Query: 230 ERVRISARWI 201 E V+ + W+ Sbjct: 920 ETVKNNIEWL 929
>IBP3_BOVIN (P20959) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 28.1 bits (61), Expect = 5.2 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +3 Query: 204 PSSADPHPLEALLQRSFERRLHASGKELGNLSSFLLGGER*NGRINE 344 P DP PL+ALL R L A+ +G L +LL NG +E Sbjct: 98 PPPGDPRPLQALLD---GRGLCANASAVGRLRPYLLPSASGNGSESE 141
>CHIT_YEAST (P29029) Endochitinase precursor (EC 3.2.1.14) (Soluble cell wall| protein 2) Length = 562 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 286 WETSAAFSSEVNGET-VELTKSDMSELDGQVLTT 384 W+ S AFS+E+NGE VE+ K+ ++ TT Sbjct: 285 WDASQAFSNELNGEPYVEILKNLLTSASQTATTT 318
>DFA1_SYNY3 (Q55393) Diflavin flavoprotein A 1 (EC 1.-.-.-) (SsATF573)| (NADH:oxygen oxidoreductase) Length = 573 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 180 GLALDAVDPSSADPHPLEALLQRSFERRLHASGKELG 290 G+ +D VD SSADP ++ L+ HASG LG Sbjct: 291 GVGVDMVDLSSADPQEIQELVG-------HASGVVLG 320
>CLPB_THET2 (Q72IK9) Chaperone clpB| Length = 854 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +3 Query: 180 GLALDAVDPSSADPHPLEALLQRSFERRLHASGKELGNLSSFLLGG 317 GLA ++ + ADP L+ L +R R G E+G + L G Sbjct: 44 GLAWRLLEKAGADPKALKELQERELSRLPKVEGAEVGQYLTSRLSG 89
>PDI_HUMIN (P55059) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| Length = 505 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = -3 Query: 386 HVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVR 219 H V+ +P+ + N VSP+ + KAA ++ + + P+ K +LE + Sbjct: 89 HGVEGYPTLKVFRGLDN--VSPYKGQRKAAAITSYMIKQSLPAVSEVTKDNLEEFK 142
>RPOA_LEPIN (Q9XD09) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (RNAP| alpha subunit) (Transcriptase alpha chain) (RNA polymerase alpha subunit) Length = 325 Score = 27.3 bits (59), Expect = 8.9 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 8/76 (10%) Frame = -3 Query: 359 SLISDFVNSTVSPFTSEEKAAEVSQF--------FATRVKPSFERALKQSLERVRISARW 204 SL+ F F +E +F FAT + S R L S+E ISA Sbjct: 5 SLLKGFKRPKKIEFNTEANTPNYGKFVAEPFERGFATTIGNSLRRTLMSSIEGAAISAIR 64 Query: 203 IDSIKSEPSLAQTVQQ 156 I+ + E S + V + Sbjct: 65 IEGVNHEFSFIEGVAE 80
>RPOA_LEPIC (Q72NI8) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (RNAP| alpha subunit) (Transcriptase alpha chain) (RNA polymerase alpha subunit) Length = 325 Score = 27.3 bits (59), Expect = 8.9 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 8/76 (10%) Frame = -3 Query: 359 SLISDFVNSTVSPFTSEEKAAEVSQF--------FATRVKPSFERALKQSLERVRISARW 204 SL+ F F +E +F FAT + S R L S+E ISA Sbjct: 5 SLLKGFKRPKKIEFNTEANTPNYGKFVAEPFERGFATTIGNSLRRTLMSSIEGAAISAIR 64 Query: 203 IDSIKSEPSLAQTVQQ 156 I+ + E S + V + Sbjct: 65 IEGVNHEFSFIEGVAE 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,498,727 Number of Sequences: 219361 Number of extensions: 779610 Number of successful extensions: 2371 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 2326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2369 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
