Clone Name | rbastl28a05 |
---|---|
Clone Library Name | barley_pub |
>EBM_ARATH (Q75W54) Mannosylglycoprotein endo-beta-mannosidase (EC 3.2.1.152)| (Endo-beta-mannosidase) (AtEBM) [Contains: Mannosylglycoprotein endo-beta-mannosidase 31 kDa subunit; Mannosylglycoprotein endo-beta-mannosidase 28 kDa subunit; Mannosylglycopro Length = 943 Score = 43.5 bits (101), Expect = 1e-04 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -3 Query: 363 SLTPGEKMTTDISFEAPEGSK--PRVILRGWNY 271 SL PGE M+ ISF AP G K PRV+L+GWNY Sbjct: 903 SLVPGESMSFKISFAAPTGMKKSPRVMLQGWNY 935
>EBM_LILLO (Q5H7P5) Mannosylglycoprotein endo-beta-mannosidase (EC 3.2.1.152)| (Endo-beta-mannosidase) [Contains: Mannosylglycoprotein endo-beta-mannosidase 31 kDa subunit; Mannosylglycoprotein endo-beta-mannosidase 28 kDa subunit; Mannosylglycoprotein end Length = 952 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -3 Query: 363 SLTPGEKMTTDISFEAPEGSKPRVILRGWNYHLNH 259 SL PGE ISFE P G PRV LRGWN H Sbjct: 914 SLVPGETTNISISFEVPHGVTPRVSLRGWNCSEEH 948
>SLAF1_CANFA (Q95MM9) Signaling lymphocytic activation molecule precursor (CD150| antigen homolog) Length = 342 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 357 TPGEKMTTDI-SFEAPEGSKPRVILRGWNYHLNH 259 +PG + I S + PEG PR + G+ +HL + Sbjct: 69 SPGNSIKKKIVSLDLPEGGSPRYLENGYKFHLEN 102
>PCX_DROME (P18490) Protein pecanex| Length = 3433 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 142 LLVYKIAKPFMSALYWGCTYFTWILF 219 L +Y + PF++ LY+ T+ TW L+ Sbjct: 38 LWLYLLCSPFVAYLYFPSTWLTWCLY 63
>NU5M_ELEMA (Q2I3G4) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 606 Score = 27.7 bits (60), Expect = 7.2 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +2 Query: 167 PSCLHFIGDVLTLHGSYSSTQLNSMTHIVTAWFR**FQPLRM-----TLGLDPS 313 P L F+ +TL G +T+LN+MTH +T F+ QP RM TLG P+ Sbjct: 486 PPHLKFMALAVTLLGFTVATELNNMTHNLT--FK---QPSRMHTFSTTLGYYPT 534
>YDH3_PLAFS (P14589) Hypothetical protein 3' to Asp-rich and His-rich| proteins (Fragment) Length = 53 Score = 27.7 bits (60), Expect = 7.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 94 CWRRLKWFRSWW 59 CWRR W R WW Sbjct: 15 CWRRRGWRRRWW 26
>GSPN_PECCC (P31710) General secretion pathway protein N (Pectic enzymes| secretion protein OUTN) Length = 248 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 333 DISFEAPEGSKPRVILRGW 277 DI+F+ PEG R I+RGW Sbjct: 80 DIAFKNPEGIAGRGIIRGW 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,873,937 Number of Sequences: 219361 Number of extensions: 985910 Number of successful extensions: 2068 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2067 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)