ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl27h07 |
|---|---|
| Clone Library Name | barley_pub |
>MT_PARLI (P80367) Metallothionein (MT)| Length = 65 Score = 32.0 bits (71), Expect = 0.39 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 327 PPASQTCMAFGQVLQIGASGCLFTCSAAAC-CT 232 P A Q C G+ + GAS C TCS AAC CT Sbjct: 15 PCAGQECCITGKCCKDGASVCCGTCSNAACKCT 47
>SODM2_HALME (O08460) Superoxide dismutase [Mn] 2 (EC 1.15.1.1) (Fragment)| Length = 146 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 215 LIYEGYVQQAAALHVNKHPDAPIWRTWP-NAMHVWE 319 L+Y+ +Q L V KH D +W P A+ VWE Sbjct: 94 LVYDPVTKQLRNLAVQKHNDGALWSAHPILALDVWE 129
>PDR1_ORYSA (Q7PC80) Probable pleiotropic drug resistance protein 1| Length = 1468 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 183 NPFHHFS*SVDCCPIWWAWNCTCCSSDFTVF 91 N F F S P+WW W C C +T++ Sbjct: 1373 NLFTGFVISRPATPVWWRWYCWICPVAWTLY 1403
>SHBG_PHOSU (Q62588) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 399 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 18 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMP 134 NS A FC W +G R++ + R N W + C P Sbjct: 353 NSSASFCLSDLWVQGQRLDIDQALNRSQNIWTHSCPHSP 391
>KUP_VIBCH (Q9KM59) Probable potassium transport system protein kup| Length = 620 Score = 28.9 bits (63), Expect = 3.3 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 9/103 (8%) Frame = -1 Query: 323 LLPKHA-WHSAKFSRLAHPGAYLHAVLLPAVRTLRKLGLSSEEETKLIIHFTISASL*IV 147 LL HA WH+ + R +P +H VLL TL LGL + +++ + Sbjct: 181 LLGAHAIWHAPQVLRALNPAYAVHFVLLYGQHTLFILGL---------VVLSVTGVEALY 231 Query: 146 APYGGHGI--------AHVVPVILLSLYPKSRFNSSSLVPKGT 42 A G GI A V+P +LL+ + + + + P G+ Sbjct: 232 ADMGHFGIKPIRIAWFALVMPSLLLNYFGQGAYLLTLSAPTGS 274
>SHBG_MOUSE (P97497) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 403 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 18 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMPTIWGNNLQTS 164 +S A FC FW +G R++ + R + W + C P+ N+ +TS Sbjct: 357 SSSASFCLSDFWVQGQRLDIDQALSRSQDIWTHSCPQRPS---NDTRTS 402
>C4AA1_DROME (Q9V7G5) Probable cytochrome P450 4aa1 (EC 1.14.-.-) (CYPIVAA1)| Length = 514 Score = 28.9 bits (63), Expect = 3.3 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 248 LLPAVRTL-RKLGLSSEEETKLIIHFTISASL*IVAPYGGHGIAHVVP 108 L P+V + RKLG EE +L H + S + PY H +AH+ P Sbjct: 378 LYPSVPLIARKLG----EEVRLAKHTLPAGSNVFICPYATHRLAHIYP 421
>VGFR3_MOUSE (P35917) Vascular endothelial growth factor receptor 3 precursor| (EC 2.7.10.1) (VEGFR-3) (Tyrosine-protein kinase receptor FLT4) Length = 1363 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 200 PPMTNLIYEGYVQQAA-ALHVNKHPDAPIWRTWPNAMHVWEAGGRN 334 PP N+ + YV +L ++ P+ TWP A V GG++ Sbjct: 29 PPTLNITEDSYVIDTGDSLSISCRGQHPLEWTWPGAQEVLTTGGKD 74
>PDR3_ORYSA (Q8GU90) Pleiotropic drug resistance protein 3| Length = 1457 Score = 28.5 bits (62), Expect = 4.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 144 PIWWAWNCTCCSSDFTVF 91 PIWW W C C +T++ Sbjct: 1375 PIWWRWYCWACPVAWTLY 1392
>NIA1_ORYSA (P16081) Nitrate reductase [NADH] 1 (EC 1.7.1.1) (NR1)| Length = 916 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 200 PPMTNLIYEGYVQQAAALHVNKHPDAP--IWRTW 295 PP+ L++ G++ AA +V H P W TW Sbjct: 125 PPLAELMHHGFITPAALHYVANHGAVPRGDWSTW 158
>SHBG_RABIT (P15196) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 398 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +3 Query: 18 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMPTIWGNNLQTS 164 +S A FC W +G +++ + R + W + C S P GN TS Sbjct: 352 DSSASFCLDGLWAQGQKLDMDKALNRSQDIWTHSCPSSP---GNGTDTS 397
>M2GD_HUMAN (Q9UI17) Dimethylglycine dehydrogenase, mitochondrial precursor (EC| 1.5.99.2) (ME2GLYDH) Length = 866 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 305 WHSAKFSRLAHPGAYLHAVLLPAVRTLRKLGLSSEEETKLIIHF 174 WH+A + HPG L + +++ KL EEET ++ F Sbjct: 90 WHAAGLTTYFHPGINLKKIHYDSIKLYEKL----EEETGQVVGF 129
>PDR2_ORYSA (Q8GU92) Probable pleiotropic drug resistance protein 2| Length = 1464 Score = 28.1 bits (61), Expect = 5.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 144 PIWWAWNCTCCSSDFTVF 91 PIWW W C C +T++ Sbjct: 1382 PIWWRWYCWICPVAWTLY 1399
>SODM1_HALME (O08461) Superoxide dismutase [Mn] 1 (EC 1.15.1.1) (Fragment)| Length = 144 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 215 LIYEGYVQQAAALHVNKHPDAPIWRTWP-NAMHVWEAGGRNELG 343 L+Y+ + Q + V+KH +W + P A+ VWE ++ G Sbjct: 92 LVYDSFSNQLRNVVVDKHDQGALWGSHPILALDVWEHSYYHDYG 135
>THYX_PYRAE (Q8ZWD6) Thymidylate synthase thyX (EC 2.1.1.148) (TS) (TSase)| Length = 244 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 230 YVQQAAALHVNKHPDAPIWRTWPN-AMHVWE 319 Y QA HV A WR WPN A VWE Sbjct: 168 YAAQAEIRHVCWQMFAHAWRLWPNLARLVWE 198
>PDR4_ORYSA (Q8GU89) Pleiotropic drug resistance protein 4| Length = 1450 Score = 27.7 bits (60), Expect = 7.3 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 144 PIWWAWNCTCCSSDFTVF 91 P+WW W C C +T++ Sbjct: 1367 PVWWRWYCWICPVAWTLY 1384
>BCSB2_ACEXY (O82860) Cyclic di-GMP-binding protein precursor (Cellulose| synthase regulatory subunit) (Cellulose synthase protein B) (CDGBP) Length = 802 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 197 LPPMTNLIYEGYVQQAAALHVNKHPDAPIWRTWPNAMHV 313 L P + L EGY A A+ PD WR PN ++V Sbjct: 388 LVPDSALQAEGYAPGALAVPFRVSPDLYTWRDRPNKLNV 426
>SODM1_HALVO (Q03300) Superoxide dismutase [Mn] 1 (EC 1.15.1.1)| Length = 200 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 215 LIYEGYVQQAAALHVNKHPDAPIWRTWP-NAMHVWEAGGRNELG 343 L+Y+ + Q + V+KH +W + P A+ VWE ++ G Sbjct: 126 LVYDSFSNQLRNVVVDKHDQGALWGSHPILALDVWEHSYYHDYG 169
>SODM2_HALVO (Q03301) Superoxide dismutase [Mn] 2 (EC 1.15.1.1)| Length = 199 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 215 LIYEGYVQQAAALHVNKHPDAPIWRTWP-NAMHVWEAGGRNELG 343 L+Y+ + Q + V+KH +W + P A+ VWE ++ G Sbjct: 125 LVYDSFSNQLRNVVVDKHDQGALWGSHPILALDVWEHSYYHDYG 168
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 330 RPPASQTCMAFGQVLQIGASGCLFTCSAAACC 235 R P S +C G Q G S C + + CC Sbjct: 80 RRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCC 111
>FSHB_MASCO (Q6SI68) Follitropin beta chain precursor (Follicle-stimulating| hormone beta subunit) (FSH-beta) (FSH-B) Length = 130 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = -3 Query: 159 SVDCCPIWWAWNCTCCSS----DFTVFISEESIQLVI 61 S+ C + W W CC S + T+ I +E + I Sbjct: 4 SIQLCILLWCWRAICCHSCELTNITISIEKEECRFCI 40
>NIA1_HORVU (P27967) Nitrate reductase [NADH] (EC 1.7.1.1) (NR)| Length = 915 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 200 PPMTNLIYEGYVQQAAALHVNKHPDAP--IWRTW 295 PP+ L++ G++ A +V H P W TW Sbjct: 122 PPLARLMHHGFITPAPLHYVRNHGAVPRGDWATW 155
>SRB8_YEAST (P25648) Suppressor of RNA polymerase B SRB8| Length = 1427 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 115 LFQ*FYCLYIRRVDSTRHPSFQKEHLQNFASELI 14 +FQ F C I+++ P+ E L+NF ++I Sbjct: 1088 VFQAFTCFCIKKIMENNEPAMAMEDLKNFIFQII 1121
>NIA2_HORVU (P27969) Nitrate reductase [NADH] (EC 1.7.1.1) (NR) (Fragment)| Length = 912 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 200 PPMTNLIYEGYVQQAAALHVNKHPDAP--IWRTW 295 PP+ L++ G++ A +V H P W TW Sbjct: 119 PPLARLMHHGFITPAPLHYVRNHGAVPRGDWATW 152
>MPIP1_CAEEL (O44552) M-phase inducer phosphatase cdc-25.1 (EC 3.1.3.48) (Cell| division cycle-related protein 25.1) Length = 604 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 25 LQNSANVPFGTRDDELNRLFGYKDSKITGTTC-AIPCPPYGATIYRLA 165 L N + PFG DDE+ ++S++ T+ A P P +++ LA Sbjct: 178 LNNPRDDPFGDEDDEVFEQSNVRNSQVQNTSIFAQPAPRTATSLWDLA 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,473,514 Number of Sequences: 219361 Number of extensions: 1175179 Number of successful extensions: 3443 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3443 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
