Clone Name | rbastl27h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENP2_HUMAN (Q9Y5L3) Ectonucleoside triphosphate diphosphohydrola... | 29 | 3.1 | 2 | Y1276_MYCTU (Q11043) Hypothetical protein Rv1276c/MT1313 | 28 | 7.0 | 3 | BPHF_BURCE (P37332) Biphenyl dioxygenase system ferredoxin subunit | 27 | 9.1 | 4 | CARB_CLOAB (Q97FT3) Carbamoyl-phosphate synthase large chain (EC... | 27 | 9.1 |
---|
>ENP2_HUMAN (Q9Y5L3) Ectonucleoside triphosphate diphosphohydrolase 2 (EC| 3.6.1.-) (NTPDase2) (Ecto-ATPase) (CD39 antigen-like 1) Length = 495 Score = 28.9 bits (63), Expect = 3.1 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = -1 Query: 284 LLGKNYITPCKLQV---DCHAATLTRLSGVNLDHVC*QK*SGLWSFPRMYC*TCLFPCLF 114 LLG Y +PC + + +++ LSG + H+C SGL+SF C F +F Sbjct: 275 LLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVF 334 Query: 113 YP 108 P Sbjct: 335 QP 336
>Y1276_MYCTU (Q11043) Hypothetical protein Rv1276c/MT1313| Length = 158 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 227 WQHGNRPGVCTVLCSSSPEASRV*FHTG 310 W N P V VLCS++ A + HTG Sbjct: 33 WLRANLPAVDAVLCSTATRARQTLAHTG 60
>BPHF_BURCE (P37332) Biphenyl dioxygenase system ferredoxin subunit| Length = 109 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 80 ELQVLCSHCTHGTWMVEEAGYMQ 12 EL CTHG W + + GY++ Sbjct: 35 ELFATQDRCTHGDWSLSDGGYLE 57
>CARB_CLOAB (Q97FT3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 27.3 bits (59), Expect = 9.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 56 CTHGTWMVEEAGY 18 C HG W ++EAGY Sbjct: 576 CVHGVWAIKEAGY 588 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,084,515 Number of Sequences: 219361 Number of extensions: 1027294 Number of successful extensions: 2176 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2176 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)