Clone Name | rbastl27g12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ADA33_MOUSE (Q923W9) ADAM 33 precursor (EC 3.4.24.-) (A disinteg... | 28 | 4.8 | 2 | PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosp... | 28 | 8.1 | 3 | LYOX_CHICK (Q05063) Protein-lysine 6-oxidase precursor (EC 1.4.3... | 28 | 8.1 |
---|
>ADA33_MOUSE (Q923W9) ADAM 33 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 33) Length = 797 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 7/59 (11%) Frame = -3 Query: 186 KLSSAGYRSMHRRVQKKSLVLPNNEVDGVMFPPALRCFSSSWQT-------SGIVVIFS 31 KL + GY H R +VL N D + +R F SW SG++V+ S Sbjct: 87 KLLAPGYTETHYRPDGHPVVLSPNHTDHCQYHGRVRGFRESWVVLSTCSGMSGLIVLSS 145
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 87 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSDPSCTHPYC 227 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361
>LYOX_CHICK (Q05063) Protein-lysine 6-oxidase precursor (EC 1.4.3.13) (Lysyl| oxidase) Length = 420 Score = 27.7 bits (60), Expect = 8.1 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 14/82 (17%) Frame = +3 Query: 51 LRFAKKKKNNGGPE--------GTSHHRLH-YWAKQGIFSAHD--DALTGSQLS*---AS 188 LRF ++ KN G + H H ++ FS +D DA + +++ AS Sbjct: 266 LRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASSHRKVAEGHKAS 325 Query: 189 ACRSDPSCTHPYCLNYSCTGTT 254 C D SC + Y Y+CT T Sbjct: 326 FCLEDTSCDYGYYRRYACTAHT 347 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,338,001 Number of Sequences: 219361 Number of extensions: 793205 Number of successful extensions: 2048 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2047 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)