ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl27g09 |
|---|---|
| Clone Library Name | barley_pub |
>CD48D_ARATH (Q9SCN8) Putative cell division control protein 48 homolog D| (AtCDC48d) (Transitional endoplasmic reticulum ATPase D) Length = 815 Score = 64.7 bits (156), Expect = 6e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFPDQP 237 SDADIRKYQAFAQTLQQSRGFGSEFRFPD P Sbjct: 751 SDADIRKYQAFAQTLQQSRGFGSEFRFPDAP 781
>CDC48_SOYBN (P54774) Cell division cycle protein 48 homolog (Valosin-containing| protein homolog) (VCP) Length = 807 Score = 60.8 bits (146), Expect = 8e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFPD 243 SDADIRKYQAFAQTLQQSRGFGSEFRFP+ Sbjct: 753 SDADIRKYQAFAQTLQQSRGFGSEFRFPE 781
>CDC48_CAPAN (Q96372) Cell division cycle protein 48 homolog| Length = 805 Score = 58.2 bits (139), Expect = 5e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFPD 243 SDADIRKYQAFAQTLQQSRGFG+EFRF D Sbjct: 751 SDADIRKYQAFAQTLQQSRGFGTEFRFAD 779
>CD48E_ARATH (Q9LZF6) Cell division control protein 48 homolog E (AtCDC48e)| (Transitional endoplasmic reticulum ATPase E) Length = 810 Score = 57.4 bits (137), Expect = 9e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRF 249 SDADIRKYQAFAQTLQQSRGFGSEFRF Sbjct: 752 SDADIRKYQAFAQTLQQSRGFGSEFRF 778
>CD48A_ARATH (P54609) Cell division control protein 48 homolog A (AtCDC48a)| Length = 809 Score = 57.4 bits (137), Expect = 9e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRF 249 SDADIRKYQAFAQTLQQSRGFGSEFRF Sbjct: 752 SDADIRKYQAFAQTLQQSRGFGSEFRF 778
>TERA1_CAEEL (P54811) Transitional endoplasmic reticulum ATPase homolog 1| (p97/CDC48 homolog 1) Length = 809 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFPDQ 240 +D DIRKY+ FAQTLQQSRGFG+ F+FP + Sbjct: 759 TDNDIRKYEMFAQTLQQSRGFGNNFKFPGE 788
>TERA2_CAEEL (P54812) Transitional endoplasmic reticulum ATPase homolog 2| (p97/CDC48 homolog 2) Length = 810 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFPDQ 240 +D DIRKY+ FAQTLQQSRGFG+ F+FP + Sbjct: 757 TDNDIRKYEMFAQTLQQSRGFGNNFKFPGE 786
>TERA_XENLA (P23787) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) Length = 805 Score = 48.1 bits (113), Expect = 5e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFP 246 SD DIRKY+ FAQTLQQSRGFGS FRFP Sbjct: 748 SDNDIRKYEMFAQTLQQSRGFGS-FRFP 774
>TERA_RAT (P46462) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 48.1 bits (113), Expect = 5e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFP 246 SD DIRKY+ FAQTLQQSRGFGS FRFP Sbjct: 747 SDNDIRKYEMFAQTLQQSRGFGS-FRFP 773
>TERA_PIG (P03974) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 48.1 bits (113), Expect = 5e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFP 246 SD DIRKY+ FAQTLQQSRGFGS FRFP Sbjct: 747 SDNDIRKYEMFAQTLQQSRGFGS-FRFP 773
>TERA_MOUSE (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 48.1 bits (113), Expect = 5e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFP 246 SD DIRKY+ FAQTLQQSRGFGS FRFP Sbjct: 747 SDNDIRKYEMFAQTLQQSRGFGS-FRFP 773
>TERA_HUMAN (P55072) Transitional endoplasmic reticulum ATPase (TER ATPase)| (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Length = 805 Score = 48.1 bits (113), Expect = 5e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFP 246 SD DIRKY+ FAQTLQQSRGFGS FRFP Sbjct: 747 SDNDIRKYEMFAQTLQQSRGFGS-FRFP 773
>CDC48_YEAST (P25694) Cell division control protein 48| Length = 835 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGFGSEFRFPDQP 237 SDA++R+Y+A++Q ++ SRG S F F D P Sbjct: 770 SDAELRRYEAYSQQMKASRGQFSNFNFNDAP 800
>EC2_ARATH (Q42377) EC protein homolog 2| Length = 85 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 227 CPRPADQGTGTRCRIHGTAAESGQRPGTCGC 319 CP P G RC++ A+ Q TC C Sbjct: 19 CPSPCPGGESCRCKMMSEASGGDQEHNTCPC 49
>EC1_WHEAT (P30569) EC protein I/II (Zinc-metallothionein class II)| Length = 80 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 227 CPRPADQGTGTRCRIHGTAAESGQRPG---TCGC 319 C P GTG RC T+A SG G TCGC Sbjct: 8 CAVPCPGGTGCRC----TSARSGAAAGEHTTCGC 37
>CDC48_SCHPO (Q9P3A7) Cell division cycle protein 48| Length = 815 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -1 Query: 329 SDADIRKYQAFAQTLQQSRGF-GSEFRFPD 243 SDA++R+Y+A+A L SRG G +F D Sbjct: 768 SDAEVRRYEAYAHQLLTSRGLTGFQFDSAD 797
>NU5H_NYCOV (Q5DUY0) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 1849 Score = 27.7 bits (60), Expect = 7.5 Identities = 9/44 (20%), Positives = 26/44 (59%) Frame = -3 Query: 132 LNLPVISFVYCYVLWYARHGQTMYLKLLLGCTDIRYLPVICSCI 1 ++ ++ ++ CY++ + ++ Y+ LLL +I YL ++ + + Sbjct: 327 ISCSLLIYILCYIMTELLYSRSFYIDLLLRLLEIIYLDILVNSL 370
>EC3_WHEAT (P30570) EC protein III (Zinc-metallothionein class II)| Length = 80 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 227 CPRPADQGTGTRCRIHGTAAESGQRPGTCGC 319 C P GTG RC + A +G+ TCGC Sbjct: 8 CAVPCPGGTGCRCTSARSDAAAGEHT-TCGC 37
>STAB1_HUMAN (Q9NY15) Stabilin-1 precursor (FEEL-1 protein) (MS-1 antigen)| Length = 2570 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 248 GTGTRCRIHGTAAESGQRPGTCGCR 322 G T C HGT + R GTC C+ Sbjct: 115 GAETPCNGHGTCLDGMDRNGTCVCQ 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,286,479 Number of Sequences: 219361 Number of extensions: 570319 Number of successful extensions: 1275 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
