Clone Name | rbastl27g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MATK_DALWR (Q6TND0) Maturase K (Intron maturase) | 29 | 4.9 | 2 | MATK_DALPU (Q6TND4) Maturase K (Intron maturase) | 29 | 4.9 | 3 | FA47B_HUMAN (Q8NA70) Protein FAM47B | 28 | 6.4 |
---|
>MATK_DALWR (Q6TND0) Maturase K (Intron maturase)| Length = 512 Score = 28.9 bits (63), Expect = 4.9 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -1 Query: 159 LVVGKVLYVTLST*GSRVSVWEHYPGPVCKPQIVEHSYRMWWGLCISTVQVCL 1 L++ K Y +S +VW PG + Q+ +HS+ +WG S V++ L Sbjct: 296 LLMNKWKYYLISLWQCYFNVWSQ-PGTIYINQLSDHSFHFFWGGYFSNVRLNL 347
>MATK_DALPU (Q6TND4) Maturase K (Intron maturase)| Length = 509 Score = 28.9 bits (63), Expect = 4.9 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -1 Query: 159 LVVGKVLYVTLST*GSRVSVWEHYPGPVCKPQIVEHSYRMWWGLCISTVQVCL 1 L++ K Y +S +VW PG + Q+ +HS+ +WG S V++ L Sbjct: 293 LLMNKWKYYLISLWQCYFNVWSQ-PGTIYINQLSDHSFHFFWGGYFSNVRLNL 344
>FA47B_HUMAN (Q8NA70) Protein FAM47B| Length = 645 Score = 28.5 bits (62), Expect = 6.4 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 389 EVQFVKVCYWDDVKPVSPHSIS 324 EV+F+++ YWD + +PHS S Sbjct: 519 EVEFLRIKYWDRRRRAAPHSYS 540 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,013,227 Number of Sequences: 219361 Number of extensions: 1266233 Number of successful extensions: 2797 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2797 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)