Clone Name | rbastl27e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IRK1_CAEEL (P52192) Inward rectifier potassium channel irk-1 | 30 | 2.3 | 2 | TMED6_HUMAN (Q8WW62) Transmembrane emp24 domain-containing prote... | 29 | 5.0 | 3 | AXUD1_MOUSE (P59054) Axin-1 up-regulated gene 1 protein (TGF-bet... | 28 | 8.6 |
---|
>IRK1_CAEEL (P52192) Inward rectifier potassium channel irk-1| Length = 505 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -1 Query: 212 LSAVYSCMLLPVQLYHTFNHSNKFASTSPTAFGRY--FYAVTNLSLKDWLVSIAFQR 48 L +VYS L V+ +HT + +++ +T G A+ L L+ ++V I F + Sbjct: 157 LDSVYSSFLFAVETHHTIGYGHRYITTECYLAGAIVCLQAICALLLQSFMVGIVFAK 213
>TMED6_HUMAN (Q8WW62) Transmembrane emp24 domain-containing protein 6 precursor| Length = 240 Score = 28.9 bits (63), Expect = 5.0 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = +3 Query: 21 TPAKKTVQRPLEGNGHQPIFEG*ICY--SIEVP---TKCCWR 131 T A+ PL G+G QP+F G Y +I +P T+C W+ Sbjct: 17 TSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQ 58
>AXUD1_MOUSE (P59054) Axin-1 up-regulated gene 1 protein (TGF-beta-induced| apoptosis protein 3) (TAIP-3) Length = 583 Score = 28.1 bits (61), Expect = 8.6 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = -2 Query: 181 QCNCIILSTIPISL----PRHRQQHLVGTSML*QIYPSKIGWCPLPSRGLCTVFFA 26 Q +C + S P S+ PR R H+ + +P G+ +PSRG CT+ A Sbjct: 59 QDSCGLQSFTPPSILKRAPRERPGHVAFNGITVYYFPRCQGFTSVPSRGGCTLGMA 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,984,737 Number of Sequences: 219361 Number of extensions: 1200561 Number of successful extensions: 3150 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3149 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)