| Clone Name | rbastl27e04 |
|---|---|
| Clone Library Name | barley_pub |
>TOP2_PLAFK (P41001) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1398 Score = 31.2 bits (69), Expect = 0.66 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +3 Query: 24 KLAQKAMEEKA*KRLLQIMKLEGLNKCNLRVDQQCLVIHVINGRRQRTFCTPKYSLKSQD 203 K KA KA +R++ I KLE N + Q+C +I + G +T C S+ +D Sbjct: 459 KKKMKAGSSKARERIIGIPKLEDANDAGSKYSQECTLI-LTEGDSAKTSCLAGLSIVGRD 517
>NUOL_RHOCA (P50939) NADH-quinone oxidoreductase chain L (EC 1.6.99.5) (NADH| dehydrogenase I, chain L) (NDH-1, chain L) Length = 712 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 230 LVATISVLIYQHRWRYWSKSEMTTWTHH 313 +V T+S L++ + W Y + E WTHH Sbjct: 86 VVTTVSALVHLYSWGYMAHDE--NWTHH 111
>BFAR_RAT (Q5PQN2) Bifunctional apoptosis regulator| Length = 450 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +2 Query: 242 ISVLIYQHRWRYWSKSEMTT-----WTHHMKV 322 +SVL WR WS+SE+ T W+H KV Sbjct: 369 LSVLELFSFWRIWSRSELKTVPQRMWSHFWKV 400
>BFAR_MOUSE (Q8R079) Bifunctional apoptosis regulator| Length = 450 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +2 Query: 242 ISVLIYQHRWRYWSKSEMTT-----WTHHMKV 322 +SVL WR WS+SE+ T W+H KV Sbjct: 369 LSVLELFSFWRIWSRSELKTVPQRMWSHFWKV 400
>BFAR_HUMAN (Q9NZS9) Bifunctional apoptosis regulator (RING finger protein 47)| Length = 450 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +2 Query: 242 ISVLIYQHRWRYWSKSEMTT-----WTHHMKV 322 +SVL WR WS+SE+ T W+H KV Sbjct: 369 LSVLELFSFWRIWSRSELKTVPQRMWSHFWKV 400
>SCRB1_PIG (Q8SQC1) Scavenger receptor class B member 1 (SRB1) (SR-BI) (High| density lipoprotein receptor SR-BI) Length = 509 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 63 RLLQIMKLEGLNKCNLRVDQQCLVIHVINGRRQRTFCTPKYSLK 194 R+ + K GL+K N QC +I+ +G+ F TP+ SL+ Sbjct: 230 RIHLVDKWNGLSKVNFWHSDQCNMINGTSGQMWAPFMTPESSLE 273
>REGQ_BP82 (P13870) Antitermination protein Q| Length = 229 Score = 27.7 bits (60), Expect = 7.3 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 236 ATISVLIYQHRWRYWSKSEMTTWTHHMKVDE 328 A +S+ +Q W WS SE W H + + + Sbjct: 93 AVLSLEEHQKAWLLWSYSESVRWEHQVTITQ 123
>LIP_STAEP (P0C0R3) Lipase precursor (EC 3.1.1.3) (Glycerol ester hydrolase)| Length = 688 Score = 27.3 bits (59), Expect = 9.6 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 154 DGNELFVHQNIPSRVKINETSLSRSISCN-NFSSDLPA*MEILEQKRDDHMDASYE 318 DGNE Q +NE S SI+ N + ++ P ++++Q++D D E Sbjct: 55 DGNEKLSEQQSTQNKNVNEKSNVNSITENESLHNETPKNEDLIQQQKDSQNDNKSE 110
>CGR1_CANGA (O74208) ATP-binding cassette transporter CGR1 (Pleomorphic drug| resistance homolog) Length = 1542 Score = 27.3 bits (59), Expect = 9.6 Identities = 20/68 (29%), Positives = 30/68 (44%) Frame = +2 Query: 131 GHSCDKRQTATNFLYTKIFPQESRLMKPAFREALVATISVLIYQHRWRYWSKSEMTTWTH 310 G+ C KRQT +FL + P E R+ K + + + L YW SE Sbjct: 404 GYFCPKRQTIPDFLTSITSPAERRINKEYLDKGIKVPQTPL---DMVEYWHNSEEYKQLR 460 Query: 311 HMKVDETV 334 ++DET+ Sbjct: 461 E-EIDETL 467 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,996,732 Number of Sequences: 219361 Number of extensions: 664308 Number of successful extensions: 1522 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1522 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)