Clone Name | rbastl27d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TF3C1_RAT (Q63505) General transcription factor 3C polypeptide 1... | 28 | 6.9 | 2 | GLIS1_HUMAN (Q8NBF1) Zinc finger protein GLIS1 (GLI-similar 1) | 28 | 9.0 |
---|
>TF3C1_RAT (Q63505) General transcription factor 3C polypeptide 1| (Transcription factor IIIC-alpha subunit) (TF3C-alpha) (TFIIIC 220 kDa subunit) (TFIIIC220) (TFIIIC box B-binding subunit) Length = 2148 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 289 HSAACWSVGPGSSPHHH-PCSFSWQRSSXRP 378 HS A GPGS PHH P W+ + P Sbjct: 501 HSRASGDAGPGSRPHHSTPAKGGWKVLNLHP 531
>GLIS1_HUMAN (Q8NBF1) Zinc finger protein GLIS1 (GLI-similar 1)| Length = 620 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -2 Query: 315 SDAPAGCGVSNHLTPGLVSALTTYHSGHLTRSCLP 211 SD GCG+ L PG+ T H+G L LP Sbjct: 386 SDGKGGCGLGQELLPGVYPGSITPHNG-LASGLLP 419 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,216,102 Number of Sequences: 219361 Number of extensions: 950319 Number of successful extensions: 2296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2296 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)