Clone Name | rbastl27b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PGTA_MOUSE (Q9JHK4) Geranylgeranyl transferase type-2 alpha subu... | 30 | 2.1 | 2 | PGTA_RAT (Q08602) Geranylgeranyl transferase type-2 alpha subuni... | 28 | 6.0 | 3 | ERF1A_ARATH (O80337) Ethylene-responsive transcription factor 1A... | 28 | 7.9 | 4 | APC_XENLA (P70039) Adenomatous polyposis coli homolog (Protein APC) | 28 | 7.9 |
---|
>PGTA_MOUSE (Q9JHK4) Geranylgeranyl transferase type-2 alpha subunit (EC| 2.5.1.60) (Geranylgeranyl transferase type II alpha subunit) (Rab geranylgeranyltransferase alpha subunit) (Rab geranyl-geranyltransferase alpha subunit) (Rab GG transferase alpha) ( Length = 567 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 84 VLCCSSVNENDVCLWTCFDRLLI 16 VLCC V+ + CL CF R LI Sbjct: 244 VLCCLHVSREEACLSVCFSRPLI 266
>PGTA_RAT (Q08602) Geranylgeranyl transferase type-2 alpha subunit (EC| 2.5.1.60) (Geranylgeranyl transferase type II alpha subunit) (Rab geranylgeranyltransferase alpha subunit) (Rab geranyl-geranyltransferase alpha subunit) (Rab GG transferase alpha) (Ra Length = 567 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 84 VLCCSSVNENDVCLWTCFDRLL 19 VLCC V+ + CL CF R L Sbjct: 244 VLCCVHVSREEACLSVCFSRPL 265
>ERF1A_ARATH (O80337) Ethylene-responsive transcription factor 1A| (Ethylene-responsive element-binding factor 1A) (EREBP-1A) (AtERF1) Length = 268 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 201 REIIGETETIMFESLSLV*T*GCVTGQ 121 R ++GE+E I+ ES + T CVTGQ Sbjct: 19 RHLLGESEPILSESTASSVTQSCVTGQ 45
>APC_XENLA (P70039) Adenomatous polyposis coli homolog (Protein APC)| Length = 2829 Score = 27.7 bits (60), Expect = 7.9 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Frame = +2 Query: 26 RSKQVHKQ---TSFSLTEEQHNTLACLLIRQTTGTCPVTQPYVYTSESDSNIIVSVSPMI 196 R+KQ HKQ + ++L +H+ C + G V PY+ T+ S SP Sbjct: 788 RNKQRHKQNLCSEYALDSSRHDDSICRSDNFSIGNLTVLSPYINTTVLPG----SSSPRP 843 Query: 197 SLSHRRASKGR 229 ++ R K R Sbjct: 844 TMDGSRPEKDR 854 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,210,241 Number of Sequences: 219361 Number of extensions: 587813 Number of successful extensions: 1491 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1491 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)