Clone Name | rbastl27a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IPNS_STRJU (P18286) Isopenicillin N synthetase (EC 1.21.3.1) (IP... | 30 | 2.4 |
---|
>IPNS_STRJU (P18286) Isopenicillin N synthetase (EC 1.21.3.1) (IPNS)| (Isopenicillin N synthase) Length = 329 Score = 30.0 bits (66), Expect = 2.4 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 4 GSNISHVTHTRYPLINSRIKLRSKSIRFSYP*LIKLQNKQIVSPF 138 G+ + H+TH +P N R+K + R S P + + ++ PF Sbjct: 252 GTYMGHITHDYFPAPNHRVKFINAE-RLSLPFFLNAGHNSVIEPF 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,513,784 Number of Sequences: 219361 Number of extensions: 1023382 Number of successful extensions: 1702 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1699 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)