Clone Name | rbastl27a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CYNT_SYNP7 (P27134) Carbonic anhydrase (EC 4.2.1.1) | 32 | 0.79 | 2 | YCQ9_SCHPO (O13674) Hypothetical RNA-binding protein C74.09 in c... | 30 | 2.3 | 3 | CYPC_BACSU (O31440) Cytochrome P450 152A1 (EC 1.14.-.-) (P450BsB... | 28 | 8.7 |
---|
>CYNT_SYNP7 (P27134) Carbonic anhydrase (EC 4.2.1.1)| Length = 272 Score = 32.0 bits (71), Expect = 0.79 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 8/82 (9%) Frame = -1 Query: 318 VEVIEASNVVMQMKFWALVDIVIFLLFSARVLLFM*HFKVKFG--------SWDDTA*GT 163 VE++ A NV+ Q++ IV LF ++ +F ++V+ G S DDT Sbjct: 147 VEILVAENVLTQIENLKTYPIVRSRLFQGKLQIFGWIYEVESGEVLQISRTSSDDTGIDE 206 Query: 162 CAVRNPGHDIKELADHSWHPYT 97 C VR PG K + P T Sbjct: 207 CPVRLPGSQEKAILGRCVVPLT 228
>YCQ9_SCHPO (O13674) Hypothetical RNA-binding protein C74.09 in chromosome III| Length = 654 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 6 KKVHVEYENFNKLQSTNILLKSLVAEVHFITYKDATSDLPVL*C 137 K++ + F K++ IL K +A VHF+ +DA + L C Sbjct: 313 KEIEEAFGKFGKIEHIKILSKKNIAFVHFLNIRDAIKVVRTLSC 356
>CYPC_BACSU (O31440) Cytochrome P450 152A1 (EC 1.14.-.-) (P450BsBeta) (Fatty| acid beta-hydroxylase) Length = 417 Score = 28.5 bits (62), Expect = 8.7 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = +2 Query: 152 LTAQVPHAVSSQEPNFTLK---CYINNRTLALNKRKITMSTRAQNFICITTLEAS 307 + Q+PH S LK +I NRT N +NFIC+T EA+ Sbjct: 1 MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGKNFICMTGAEAA 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,963,717 Number of Sequences: 219361 Number of extensions: 1107149 Number of successful extensions: 2130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2130 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)