Clone Name | rbastl26h06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RA51B_MOUSE (O35719) DNA repair protein RAD51 homolog 2 (R51H2) ... | 30 | 1.4 | 2 | OS24_PLABA (Q04620) 24 kDa ookinete surface protein precursor (P... | 29 | 2.4 | 3 | ACSA_BRAJA (Q89WV5) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (A... | 29 | 3.2 | 4 | ZAN_MOUSE (O88799) Zonadhesin precursor | 28 | 7.1 | 5 | CELR2_MOUSE (Q9R0M0) Cadherin EGF LAG seven-pass G-type receptor... | 27 | 9.3 |
---|
>RA51B_MOUSE (O35719) DNA repair protein RAD51 homolog 2 (R51H2) (RAD51-like| protein 1) Length = 350 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 336 STLVCALRQVDISLHAGVPDRSSSQYLGDPHCVPQHFSLL 217 ST +CAL D +LH GVP S ++ G P C F ++ Sbjct: 84 STTLCAL---DEALHGGVPCGSLTEITGPPGCGKTQFCIM 120
>OS24_PLABA (Q04620) 24 kDa ookinete surface protein precursor (Pbs21)| Length = 213 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 86 VKKMCGE*TVCVMSKNFGLE 27 + K+CGE ++C+ NFGLE Sbjct: 70 INKVCGEYSICINQGNFGLE 89
>ACSA_BRAJA (Q89WV5) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (Acetate--CoA| ligase) (Acyl-activating enzyme) Length = 648 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +1 Query: 16 PSYHSNPKFFDITQTVHSPHIFFTNGSPLRLTFRGGPVELKATNAMNLK 162 P+Y N +F+++ H + F+T + +R +GG +K T+ +L+ Sbjct: 331 PNYPDNSRFWNVIDK-HKVNTFYTAPTAIRALMQGGDEPVKKTSRASLR 378
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = +2 Query: 224 LKCWGTQCGSPKY*LEERSGTPACKEMSTCRRAHTSVEASREPSRPS 364 ++CW QC Y G+ C ++S AH+ P PS Sbjct: 2430 MRCWDFQCPPGTYCKNSNDGSSNCVKISLQCPAHSKFTDCLPPCHPS 2476
>CELR2_MOUSE (Q9R0M0) Cadherin EGF LAG seven-pass G-type receptor 2 precursor| (Flamingo 1) (mFmi1) Length = 2920 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 212 TTRSLT*RPFVLYLAVHFRFIAFVAFSSTGPPRN 111 TTRS RPF+ + +H RF +A S RN Sbjct: 1369 TTRSFPARPFITFRGLHQRFHFTLALSFATKERN 1402 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,094,535 Number of Sequences: 219361 Number of extensions: 929026 Number of successful extensions: 1999 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1998 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)