Clone Name | rbastl26h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RFA1_CHICK (Q5ZJJ2) Replication protein A 70 kDa DNA-binding sub... | 30 | 1.4 | 2 | PUR2_RHIME (Q92RL0) Phosphoribosylamine--glycine ligase (EC 6.3.... | 28 | 4.2 |
---|
>RFA1_CHICK (Q5ZJJ2) Replication protein A 70 kDa DNA-binding subunit (RP-A)| (RF-A) (Replication factor-A protein 1) (p70) Length = 614 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +3 Query: 6 AGDAMPVINAPQNALNRQGIPRHTKT*GERNITCEDITK*NDYDSFW 146 AG A P +AP N ++ P KT G I N Y S W Sbjct: 148 AGSAAPKYHAPSNQFSKASAPSSVKTPGGTQSKVVPIASLNPYQSKW 194
>PUR2_RHIME (Q92RL0) Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS)| (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) Length = 423 Score = 28.5 bits (62), Expect = 4.2 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 13/69 (18%) Frame = +1 Query: 124 KMTMIRFGAREYSLVQHISSTP*-TRRWEAKGKG------------REPLAQAISFCTFH 264 K+ +I G RE++L I+ +P T+ + A G E + FC H Sbjct: 2 KVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRTH 61 Query: 265 AVPFLIEGP 291 A+ F++ GP Sbjct: 62 AIDFVVVGP 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,843,824 Number of Sequences: 219361 Number of extensions: 1097615 Number of successful extensions: 2212 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2210 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)