Clone Name | rbastl26g12 |
---|---|
Clone Library Name | barley_pub |
>SPR1_YEAST (P32603) Sporulation-specific glucan 1,3-beta-glucosidase precursor| (EC 3.2.1.58) (Exo-1,3-beta-glucanase) Length = 445 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 130 LSSEEMTQEWKKEASGCILWCMRTLNVILWDA*NVVQ 20 L + EMT W I+WC +T N I WD ++Q Sbjct: 398 LDAFEMTGGW-------IMWCYKTENSIEWDVEKLIQ 427
>SPR1_SACBA (Q876J2) Sporulation-specific glucan 1,3-beta-glucosidase precursor| (EC 3.2.1.58) (Exo-1,3-beta-glucanase) Length = 445 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 130 LSSEEMTQEWKKEASGCILWCMRTLNVILWDA*NVVQ 20 L + EMT W I+WC +T N I WD ++Q Sbjct: 398 LDAFEMTGGW-------IMWCYKTENSIEWDVEKLIQ 427
>MRP_STRSU (P32653) Muramidase-released protein precursor (136 kDa surface| protein) Length = 1256 Score = 27.7 bits (60), Expect = 8.7 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 45 KITFRVLIHHKMQPEAS--FFHSCVISSLDSNLATTYDAPNASVNCKGS 185 + T VL + ++P S F H +++ +SN+ TYD AS N G+ Sbjct: 292 RTTGDVLEKYTIEPGESVTFSHPTKVNANNSNITVTYDTSLASANTPGA 340
>PSD3_HUMAN (O43242) 26S proteasome non-ATPase regulatory subunit 3 (26S| proteasome regulatory subunit S3) (Proteasome subunit p58) Length = 534 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 53 IQSSHTPQNATRSFLLPFL 109 +Q T NATR FLLPFL Sbjct: 117 VQGFFTSNNATRDFLLPFL 135
>PSD3_MOUSE (P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S| proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen) Length = 530 Score = 27.7 bits (60), Expect = 8.7 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 11/45 (24%) Frame = +2 Query: 8 PQLVLDNISCIPQNNIQSSH-----------TPQNATRSFLLPFL 109 P+ VL + +P + + +H T NATR FLLPFL Sbjct: 87 PRFVLRALRMLPSTSRRLNHYVLYKAVHGFFTSNNATRDFLLPFL 131
>TENS1_HUMAN (Q9HBL0) Tensin-1| Length = 1735 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 63 LIHHKMQ-PEASFFHSCVISSLDSNLATTYDAPN 161 L HH+M P + FH +SS S+ ATT +P+ Sbjct: 1212 LSHHQMMGPPGTGFHGSTVSSPQSSAATTPGSPS 1245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,467,102 Number of Sequences: 219361 Number of extensions: 496317 Number of successful extensions: 2055 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2055 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)