| Clone Name | rbastl26g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-rela... | 30 | 1.8 | 2 | IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-r... | 29 | 2.3 | 3 | CLH_YEAST (P22137) Clathrin heavy chain | 28 | 6.8 | 4 | PFP_AMYMD (Q9AGC0) Pyrophosphate--fructose 6-phosphate 1-phospho... | 28 | 6.8 | 5 | GUN_BACS1 (P06564) Endoglucanase precursor (EC 3.2.1.4) (Endo-1,... | 27 | 8.9 |
|---|
>IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-related| T-cell-derived-inducible factor) (IL-TIF) (IL-TIF alpha) (Interleukin-22a) (IL-22a) Length = 179 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 177 SSSILLVVLWAVENSSYPVASWCKVE 254 +S +LL+ LWA E ++ PV + CK+E Sbjct: 18 ASCLLLIALWAQEANALPVNTRCKLE 43
>IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-related| T-cell-derived-inducible factor beta) (IL-TIFb) (IL-TIF beta) Length = 179 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 177 SSSILLVVLWAVENSSYPVASWCKVE 254 +S +LL+ LWA E ++ P+ + CK+E Sbjct: 18 ASCLLLIALWAQEANALPINTRCKLE 43
>CLH_YEAST (P22137) Clathrin heavy chain| Length = 1653 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -1 Query: 152 SHKTIMSSQCLENYTLCLGIEFCMVFNNRMSANSPWLVGVY 30 S K + + LENYT I+ C+V N + + WLVG + Sbjct: 623 SEKAGLYQRALENYTDIKDIKRCVVHTNALPID--WLVGYF 661
>PFP_AMYMD (Q9AGC0) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase| (EC 2.7.1.90) (6-phosphofructokinase, pyrophosphate dependent) (Pyrophosphate-dependent 6-phosphofructose-1-kinase) (PPi-dependent phosphofructokinase) (PPi-PFK) Length = 341 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +3 Query: 81 HTKFYS*TQSVIFKTLGRHDGFMGMHSNPSYNSSSILL 194 HT S ++++ + +GRH G++ +HS + +S IL+ Sbjct: 154 HTTAESHHRALVVEVMGRHAGWIALHSGLAGGASVILV 191
>GUN_BACS1 (P06564) Endoglucanase precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Alkaline cellulase) Length = 800 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +3 Query: 126 LGRHDGFMGMHSNPSYNSSSILLVVLWAVENSSYPVASWCKVEYMHASRSP 278 L + G G SNP S ++ + A+EN Y + W ++HA P Sbjct: 112 LAMYVGENGYASNPELIKSRVIKGIDLAIENDMYVIVDW----HVHAPGDP 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,132,383 Number of Sequences: 219361 Number of extensions: 1359179 Number of successful extensions: 2872 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2872 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)