Clone Name | rbastl26g03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HSDR_STAAN (Q7A801) Type-1 restriction enzyme R protein (EC 3.1.... | 28 | 5.1 | 2 | HSDR_STAAM (Q99X26) Type-1 restriction enzyme R protein (EC 3.1.... | 28 | 5.1 | 3 | VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous... | 28 | 5.1 | 4 | FDHE_AQUAE (O67150) Protein fdhE homolog | 28 | 8.7 |
---|
>HSDR_STAAN (Q7A801) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 28.5 bits (62), Expect = 5.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 108 AFFDKKRWCKNKCEV 64 +F DKK WCKNK +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>HSDR_STAAM (Q99X26) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 28.5 bits (62), Expect = 5.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 108 AFFDKKRWCKNKCEV 64 +F DKK WCKNK +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 53 TPTQTSHLFLHHRFLSKKASSWKGVGRNHCISRGH 157 TPTQ F +HR+ +K+A + KG + + GH Sbjct: 585 TPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>FDHE_AQUAE (O67150) Protein fdhE homolog| Length = 283 Score = 27.7 bits (60), Expect = 8.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 120 FHDEAFFDKKRWCKNKCEVC 61 F D+ F+ +RW KN C VC Sbjct: 151 FADKVKFEHERWFKNYCPVC 170 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.131 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,643,546 Number of Sequences: 219361 Number of extensions: 508751 Number of successful extensions: 1537 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1537 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)