Clone Name | rbastl26f11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | URIC_RABIT (P11645) Uricase (EC 1.7.3.3) (Urate oxidase) | 28 | 4.7 | 2 | YSS2_CAEEL (Q09991) Putative serine carboxypeptidase K10B2.2 pre... | 28 | 8.1 | 3 | SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat... | 28 | 8.1 |
---|
>URIC_RABIT (P11645) Uricase (EC 1.7.3.3) (Urate oxidase)| Length = 300 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 6/55 (10%) Frame = +3 Query: 63 KSFSICLLRICTLM------IIRKHNVQHSQTWKKFNNYFYNKIQHAKAFLH*PT 209 KS + + IC ++R H WK+ N +QH AF+H PT Sbjct: 81 KSIEVFAMNICEHFLSSFNHVVRVHVYVEEVPWKRLEK---NGVQHVHAFIHTPT 132
>YSS2_CAEEL (Q09991) Putative serine carboxypeptidase K10B2.2 precursor (EC| 3.4.16.-) Length = 470 Score = 27.7 bits (60), Expect = 8.1 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +3 Query: 48 TTSAKKSFSICLLRICTLMIIRKHNVQHSQTW--KKFNNYFYNKIQHAKAFLH*PTTWPA 221 TT+ KK+F +RI + RKHN + + N + Y + LH P++ PA Sbjct: 280 TTNLKKAFIERQMRIAVGLPARKHNAATTVPLCAQTNNTHVYLNRADVRKSLHIPSSLPA 339 Query: 222 ARSC 233 C Sbjct: 340 WEEC 343
>SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat protein 2)| (Syne-2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein) Length = 6885 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 14 QVCSTDLALALDNISKKILQYMSATYMHTNDHXXXXXXXXPNLEKIQQL 160 QVC TDL LDN SK+ + + +D L+K+Q+L Sbjct: 2255 QVCVTDLNTTLDNFSKEFVSF--------SDKPVDQIAVEEKLQKLQEL 2295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,094,859 Number of Sequences: 219361 Number of extensions: 598095 Number of successful extensions: 1495 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1495 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)