| Clone Name | rbastl26f07 |
|---|---|
| Clone Library Name | barley_pub |
>VILI_DICDI (P36418) Protovillin (100 kDa actin-binding protein)| Length = 959 Score = 30.8 bits (68), Expect = 1.4 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 218 KQTTSATSHRITSPSVTRPLRFLAPTVVMFK 310 K TT+AT IT+P+VT P PTV K Sbjct: 834 KPTTAATPKPITTPTVTTPKPITTPTVATLK 864
>MYB1_NEUCR (O13493) Myb-like DNA binding protein myb-1| Length = 324 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 153 PSKPAQDHDQQVMATKTTSIFTSKLPPPH 239 PS+P Q QQ + T+ FTS PP H Sbjct: 179 PSRPQQQQQQQQQQARCTTPFTSFYPPSH 207
>TRPD2_RALSO (Q8XS00) Anthranilate phosphoribosyltransferase 2 (EC 2.4.2.18)| Length = 344 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 96 GISYTFCDHHHPKGLDLVPIRAMLSNSKVFCL 1 GI + F HHP L+P+R L+ +F L Sbjct: 147 GIGFMFAPTHHPALKQLMPVRVDLATRTIFNL 178
>SOSD1_RAT (Q642G2) Sclerostin domain-containing protein 1 precursor (Uterine| sensitization-associated gene 1 protein) (USAG-1) (Wnt-signaling modulator) Length = 206 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 81 KCMRFLRTVGYYNHVYDQILKIQRPSKPAQDHDQQVMATKTT 206 KC R+ R +H ++ + P+KPAQ H ++ A+K++ Sbjct: 164 KCKRYTRQHNESSHNFESV----SPAKPAQHHRERKRASKSS 201
>SOSD1_MOUSE (Q9CQN4) Sclerostin domain-containing protein 1 precursor| (Ectodermal BMP inhibitor) (Ectodin) (Uterine sensitization-associated gene 1 protein) (USAG-1) (Sclerostin-like protein) Length = 206 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 81 KCMRFLRTVGYYNHVYDQILKIQRPSKPAQDHDQQVMATKTT 206 KC R+ R +H ++ + P+KPAQ H ++ A+K++ Sbjct: 164 KCKRYTRQHNESSHNFESV----SPAKPAQHHRERKRASKSS 201
>DCTA_PSESM (Q885Z9) C4-dicarboxylate transport protein| Length = 460 Score = 28.1 bits (61), Expect = 8.8 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = -2 Query: 422 STILSGMSAILSGRGCKTTLTIAEGPSPCNSV 327 S + SG SAIL R + L +AEGP+P N+V Sbjct: 424 SELASGGSAILETRP-EDDLGVAEGPTPANAV 454
>TRPD_PROMT (Q46L78) Anthranilate phosphoribosyltransferase (EC 2.4.2.18)| Length = 345 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 111 SLRFLGISYTFCDHHHPKGLDLVPIRAMLSNSKVFCL 1 +L+ LGI++ F HP ++L P+R L +F L Sbjct: 149 ALKKLGITFLFAPSWHPSLVNLAPLRKSLGVRTIFNL 185
>TRPD1_RALSO (Q8XVE7) Anthranilate phosphoribosyltransferase 1 (EC 2.4.2.18)| Length = 345 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 111 SLRFLGISYTFCDHHHPKGLDLVPIRAMLSNSKVF 7 S+ +GI + F +HHP ++ PIR L +F Sbjct: 147 SIEAVGIGFMFAPNHHPAMKNVAPIRKELGVRTLF 181 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,648,882 Number of Sequences: 219361 Number of extensions: 1053345 Number of successful extensions: 2277 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2277 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)