Clone Name | rbastl26e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CYB_TRYBO (Q33568) Cytochrome b | 30 | 1.7 | 2 | RETST_RAT (Q8VHE9) All-trans-retinol 13,14-reductase precursor (... | 28 | 6.6 |
---|
>CYB_TRYBO (Q33568) Cytochrome b| Length = 372 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -3 Query: 131 VIICQWLCRAPYYADLCLLK---YHLFVYFVML*TLNLEYF 18 + ICQW+ + + D LLK H+F+ FV+L + +F Sbjct: 160 IYICQWIWCSEFINDFTLLKLHSIHIFLPFVLLFLIGAHFF 200
>RETST_RAT (Q8VHE9) All-trans-retinol 13,14-reductase precursor (EC 1.3.99.23)| (All-trans-13,14-dihydroretinol saturase) (RetSat) (RMT-7) Length = 609 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 58 TNRWYLSKHRSA*YGARH 111 TN++YL+ HR A YGA H Sbjct: 521 TNQYYLAAHRGATYGADH 538 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,763,254 Number of Sequences: 219361 Number of extensions: 357087 Number of successful extensions: 745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)